Protein detail
CRYAB
Alpha-crystallin B chain (Alpha(B)-crystallin) (Heat shock protein beta-5) (HspB5) (Heat shock protein family B member 5) (Renal carcinoma antigen NY-REN-27) (Rosenthal fiber component)
Entry name CRYAB | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Alpha-crystallin B chain (Alpha(B)-crystallin) (Heat shock protein beta-5) (HspB5) (Heat shock protein family B member 5) (Renal carcinoma antigen NY-REN-27) (Rosenthal fiber component)
Protein Class (7)
Cancer-related genesDisease related genesHuman disease related genesPotential drug targetsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (8)
- Predicted intracellular proteins
- Potential drug targets
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Nervous system diseases:Eye disease
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CRYA2HSPB5
Gene Description
Crystallin alpha B
Chromosome
11
Position
111908564-111923722
Supporting publications (n)
1
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificPlateletsBlood Cell SpecificbasophilBlood Lineage Specificgranulocytes
Function & Pathway
Protein Function (8)
- Predicted intracellular proteins
- Potential drug targets
- Human disease related genes:Musculoskeletal diseases:Muscular diseases
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Nervous system diseases:Eye disease
Cellular Component (17)
- GO:0005634 nucleus
- GO:0005654 nucleoplasm
- GO:0005737 cytoplasm
- GO:0005739 mitochondrion
- GO:0005764 lysosome
- GO:0005829 cytosol
- GO:0009986 cell surface
- GO:0030018 Z disc
- GO:0030424 axon
- GO:0031430 M band
Page 1 of 2
Molecular Function (10)
- GO:0001540 amyloid-beta binding
- GO:0005198 structural molecule activity
- GO:0005212 structural constituent of eye lens
- GO:0005515 protein binding
- GO:0008017 microtubule binding
- GO:0042802 identical protein binding
- GO:0042803 protein homodimerization activity
- GO:0044877 protein-containing complex binding
- GO:0046872 metal ion binding
- GO:0051082 unfolded protein binding
Biological Process (3)
KEGG (2)
Reactome (3)
Canonical Pathways (2)
- M11736 Sa mmp cytokine connection
- M63 Pid avb3 opn pathway
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence33
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CRYAB | MAPK14 | Q16539 | S | 59 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CRYAB | CAT | P04040 | S | 59 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:21751351 |
| CRYAB | GKN2 | Q86XP6 | S | 59 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:25332170 |
| CRYAB | CDK2 | P24941 | S | 19 | phosphorylation | KEA | KEA:17570479 |
| CRYAB | CDK2 | P24941 | S | 45 | phosphorylation | KEA | KEA:17570479 |
| CRYAB | MAPK1 | P28482 | S | 45 | phosphorylation | KEA | KEA:16928191 |
| CRYAB | MAPK3 | P27361 | S | 45 | phosphorylation | KEA | KEA:16928191 |
| CRYAB | MAPKAPK2 | P49137 | S | 59 | phosphorylation | KEA | KEA:16928191 |
| CRYAB | PPP1CA | P62136 | S | 59 | phosphorylation | KEA | KEA:16928191 |
| CRYAB | PRKG1 | Q13976 | S | 59 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (11)
11 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | GO_Intercell | Yes | Yes | |||
| ecm | ecm | OmniPath | Yes | Yes | |||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | UniProt_location | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| secreted | secreted | UniProt_keyword | Yes | ||||
| secreted | secreted | UniProt_location | Yes |
Page 1 of 2Next
Regulatory Interaction Network (4)
4 records.
Protein Complex Composition (7)
7 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| SCF-FBX4-aLpha-B Crystallin | CRYABCUL1FBXO4SKP1 | P02511P63208Q13616Q9UKT5 | 0:0:0:0 | SPIKE | ||
| CRYABOGA | O60502P02511 | 2:2 | PDB | PDB:5vvv | ||
| ACO2ACTBACTN2CKMCRYABCSGCN1H1-5MYH2NTPCRTNNI3TNNT2TPM1ZFP36 | O75390P02511P06732P09493P16401P19429P26651P35609P45379P60709Q92616Q99798Q9BSD7Q9UKX2 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5833 | ||
| BAG3CRYABFOSGTF3C3HCFC1HSPA1BHSPA8HSPB2HSPB8NLKWIPI2 | O95817P01100P02511P0DMV9P11142P51610Q16082Q9UBE8Q9UJY1Q9Y4P8Q9Y5Q9 | 1:1:1:2:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC9146 | ||
| CRYAB | P02511 | 2 | PDB | PDB:2klrPDB:2ygdPDB:3sgpPDB:3sgrPDB:7rojPDB:3j07PDB:2n0kPDB:3sgmPDB:2y1zPDB:6bp9PDB:2y22PDB:2wj7PDB:4m5tPDB:4m5sPDB:3sgn | ||
| CRYABHSPB2HSPB8 | P02511Q16082Q9UJY1 | 1:1:1 | CompleatCFinder | Compleat:HC6283 | ||
| CRYABNYNRIN | P02511Q9P2P1 | 0:0 | hu.MAPhu.MAP2 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 31382537 |
Sequence, Structure & Domains
Sequences
Length
175
Mass
20,159
Sequence
MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFPTSTSLSPFYLRPPSFLRAPSWFDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAAPKK
3D Structural Models
Turn
125..127
Helix
86..88; 130..132
Beta Strand
68..70; 72..80; 82..84; 89..94; 97..109; 112..123; 134..137; 141..148; 157..159; 161..163
3D Structure
Electron microscopy (2); NMR spectroscopy (3); X-ray crystallography (15)
Domain & Motif Annotations
Domain (FT)
56..164; sHSP
Region
146..175; Disordered
Protein Families
Small heat shock protein (HSP20) family
Sequence Similarities
Belongs to the small heat shock protein (HSP20) family.
Clinical Relevance
Disease Involvement (5)
Cancer-related genesCardiomyopathyCataractDisease variantMyofibrillar myopathy
Related Diseases (3)
Interaction Protein (9)
ENSG00000106211ENSG00000108255ENSG00000142192ENSG00000152137ENSG00000160202ENSG00000163254ENSG00000168036ENSG00000170276ENSG00000244752
Interaction Count
9
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 32795414 | Extracellular Vesicle and Particle Biomarkers Define Multiple Human Cancers. | Among traditional exosome markers, CD9, HSPA8, ALIX, and HSP90AB1 represent pan-EVP markers, while ACTB, MSN, and RAP1B are novel pan-EVP markers. |