Protein detail

MBP

Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)

Entry name MBP	UniProt ID P02686	EVMP confidence score 0.40
Supporting publications (n) 1	Transmembrane count	Protein classification Candidate cardiovascular disease genesDisease related genesPlasma proteinsPredicted intracellular proteins

Basic Information

Protein Names

Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)

Protein Class (4)

Candidate cardiovascular disease genesDisease related genesPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Candidate cardiovascular disease genes
Disease related genes
Predicted intracellular proteins

Ensembl

ENSG00000197971

Entrez Gene Symbol

MBP

Gene Description

Myelin basic protein

Chromosome

Position

76978827-77133683

Supporting publications (n)

EVMP confidence score

0.40

Fluorescence & Localization

Tissue SpecificgallbladderCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificamygdala excitatory

Function & Pathway

Protein Function (3)

Candidate cardiovascular disease genes
Disease related genes
Predicted intracellular proteins

Cellular Component (11)

Page 1 of 2

Molecular Function (5)

KEGG

hsa04517 IgSF CAM signaling

Reactome (2)

Mediation Categories (3)

Adhesion and uptake mediationClinical-translation mediationImmune mediation

Relations & Evidence135

Enzyme-Mediated Modification (57)

57 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
MBP	MAPK1	P28482	T	229	phosphorylation	MIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:12760422 KEA:12760422 ProtMapper:12760422
MBP	MAPK1	P28482	T	96	phosphorylation	PhosphoNetworks
MBP	MAPK1	P28482	T	99	phosphorylation	PhosphoNetworksKEA	KEA:1939237 KEA:15380617
MBP	MAPK1	P28482	T	125	phosphorylation	KEA	KEA:1939237
MBP	PRKACA	P17612	S	141	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 ProtMapper:2413024
MBP	PRKACA	P17612	S	190	phosphorylation	MIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 ProtMapper:2413024
MBP	PRKACA	P17612	S	295	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 ProtMapper:2413024
MBP	PRKACA	P17612	S	146	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 ProtMapper:2413024
MBP	PRKACA	P17612	S	266	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 ProtMapper:2413024
MBP	PRKACA	P17612	T	169	phosphorylation	PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 ProtMapper:2413024

Page 2 of 6Previous Next

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver
intracellular	intracellular	LOCATE
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	OmniPath
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes
adhesion	adhesion	OmniPath	Yes	Yes
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes
plasma_membrane	plasma_membrane	Cellinker
plasma_membrane	plasma_membrane	OmniPath

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KPCA	P17252	MBP	P02686	Yes	Yes		WangPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDCui2007HINTKEACA1PhosphoSite_KEAHPRD_KEASIGNOR_ProtMapper	HINT:8375396 CA1:10460230 HPRD:2413024 KEA:2413024 ProtMapper:2413024 SIGNOR:2413024 HINT:15927069
KAPCA	P17612	MBP	P02686	Yes			PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 HPRD:2413024 ProtMapper:2413024
CN37	P09543	MBP	P02686	Yes		Yes	SIGNOR	SIGNOR:28076777
MK01	P28482	MBP	P02686	Yes		Yes	HPRD_MIMPSIGNORProtMapperHINTPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEABioGRIDHPRD_KEAphosphoELMSIGNOR_ProtMapperSPIKE_LC	SIGNOR:12760422 HINT:12588875 SIGNOR:16401070 HINT:12114318 ProtMapper:12760422 HPRD:15380617 KEA:15380617 BioGRID:11258664 HINT:22778266 ProtMapper:16401070 HINT:10371216 HINT:10958680 BioGRID:12944901 HPRD:12760422 HINT:8846788 HINT:11570821 BioGRID:10371216 HINT:10464310 SPIKE_LC:17255944 HINT:11258664 HINT:17255944 KEA:12760422 phosphoELM:1939237 HINT:10978313 KEA:1939237 HINT:17906618 HINT:11983899 ProtMapper:1939237 HPRD:9792705 HINT:12944901 HINT:9596579 HINT:14530346 SIGNOR:1939237
MK03	P27361	MBP	P02686	Yes		Yes	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDHINTPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:16401070 ProtMapper:1939237 HINT:19910486 phosphoELM:1939237 SIGNOR:16401070 HINT:21924351 HPRD:10339476 HINT:14530346 KEA:1939237 SIGNOR:1939237 HINT:17906618 HINT:11570821
UHMK1	Q8TAS1	MBP	P02686	Yes		Yes	phosphoELM_MIMPMIMPiPTMnetPhosphoPointSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapper	ProtMapper:10880969 ProtMapper:16401070 KEA:10880969 SIGNOR:16401070 phosphoELM:10880969 SIGNOR:10880969
KPCD1	Q15139	MBP	P02686	Yes	Yes		PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetWangPhosphoSite	PhosphoSite:17939756

Protein Complex Composition (61)

61 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
ATP6V0D1 CAPN15 CHMP1A CHMP1B CHMP2A CHMP3 CHMP4B CHMP5 PTPN23 STAMBP UBC USP8 VPS4A VPS4B VTA1	O43633 O75351 O75808 O95630 P0CG48 P40818 P61421 Q7LBR1 Q9H3S7 Q9H444 Q9HD42 Q9NP79 Q9NZZ3 Q9UN37 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5455
CHMP1A CHMP1B CHMP2A CHMP3 CHMP4A CHMP4B CHMP5 GOLT1B ISG15 STAMBP UBC URGCP VPS4A VPS4B VTA1	O43633 O75351 O95630 P05161 P0CG48 Q7LBR1 Q8TCY9 Q9BY43 Q9H444 Q9HD42 Q9NP79 Q9NZZ3 Q9UN37 Q9Y3E0 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5375
CHMP1A CHMP1B CHMP2A CHMP3 CHMP4A CHMP4B CHMP5 DDX24 PTPN23 STAMBP UBC USP8 VPS4A VPS4B VTA1	O43633 O75351 O95630 P0CG48 P40818 Q7LBR1 Q9BY43 Q9GZR7 Q9H3S7 Q9H444 Q9HD42 Q9NP79 Q9NZZ3 Q9UN37 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8192
APEH CHMP1A CHMP1B CHMP2A CHMP3 CHMP4B CHMP4C CHMP5 IST1 LSM4 STAMBP USP8 VPS4A VPS4B VTA1	O43633 O75351 O95630 P13798 P40818 P53990 Q7LBR1 Q96CF2 Q9H444 Q9HD42 Q9NP79 Q9NZZ3 Q9UN37 Q9Y3E7 Q9Y4Z0	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7073
ALDH9A1 CHMP1A CHMP1B CHMP2A CHMP3 CHMP4A CHMP4B CHMP4C CHMP5 HSPA4 STAMBP USP8 VPS4A VPS4B VTA1	O43633 O75351 O95630 P34932 P40818 P49189 Q7LBR1 Q96CF2 Q9BY43 Q9H444 Q9HD42 Q9NP79 Q9NZZ3 Q9UN37 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC8117
CHMP1B CHMP2A CHMP2B CHMP3 CHMP4B CTRL CYP4F3 DYM IST1 LSM12 STAMBP VPS4B	O43633 O75351 O95630 P40313 P53990 Q08477 Q3MHD2 Q7LBR1 Q7RTS9 Q9H444 Q9UQN3 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5036
CHMP1B CHMP2A CHMP2B CHMP3 CHMP4B CTRL CYP4F22 IST1 LSM12 MIB2 STAMBP VPS4B	O43633 O75351 O95630 P40313 P53990 Q3MHD2 Q6NT55 Q7LBR1 Q96AX9 Q9H444 Q9UQN3 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4223
CHMP1B CHMP2A CHMP2B CHMP3 CHMP4B CTRL CYP4F11 DYM IST1 MIB2 STAMBP VPS4B	O43633 O75351 O95630 P40313 P53990 Q7LBR1 Q7RTS9 Q96AX9 Q9H444 Q9HBI6 Q9UQN3 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC9418
ATP6V0D1 CAPN7 CHMP1A CHMP1B CHMP2A CHMP3 CHMP4B CHMP4C CHMP5 IST1 STAMBP USP8 VPS4A VPS4B VTA1	O43633 O75351 O95630 P40818 P53990 P61421 Q7LBR1 Q96CF2 Q9H444 Q9HD42 Q9NP79 Q9NZZ3 Q9UN37 Q9Y3E7 Q9Y6W3	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5494
CHMP1A CHMP1B CHMP2A CHMP3 CHMP4A CHMP4B CHMP4C CHMP5 GOLT1B STAMBP URGCP USP8 VPS4A VPS4B VTA1	O43633 O75351 O95630 P40818 Q7LBR1 Q8TCY9 Q96CF2 Q9BY43 Q9H444 Q9HD42 Q9NP79 Q9NZZ3 Q9UN37 Q9Y3E0 Q9Y3E7	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3832

Page 2 of 7Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	R Sequencing	2	27894104 38321535

Sequence, Structure & Domains

Sequences

Length

304

Mass

33,117

Sequence

MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR

Alternative Products

Event=Alternative splicing; Named isoforms=6; Comment=Additional isoforms seem to exist.; Name=1; Synonyms=Golli-MBP1, HOG7; IsoId=P02686-1; Sequence=Displayed; Name=2; Synonyms=Golli-MBP2, HOG5; IsoId=P02686-2; Sequence=VSP_003311; Name=3; Synonyms=MBP1, 21.5 kDa; IsoId=P02686-3; Sequence=VSP_003308, VSP_003309; Name=4; Synonyms=MBP2, 20.2 kDa; IsoId=P02686-4; Sequence=VSP_003308, VSP_003309, VSP_003310; Name=5; Synonyms=MBP3, 18.5 kDa; IsoId=P02686-5; Sequence=VSP_003308; Name=6; Synonyms=MBP4, 17.2 kDa; IsoId=P02686-6; Sequence=VSP_003308, VSP_003310

Alternative Sequence

1..133; Missing (in isoform 3, isoform 4, isoform 5 and isoform 6); 192; K -> KVPWLKPGRSPLPSHARSQPGLCNMYK (in isoform 3 and isoform 4); 193..304; DSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR -> VSSEE (in isoform 2); 240..250; Missing (in isoform 4 and isoform 6)

3D Structural Models

3D Structure

X-ray crystallography (6)

Domain & Motif Annotations

Compositional Bias

1..12; Basic and acidic residues; 22..32; Basic and acidic residues; 51..65; Polar residues; 95..113; Basic and acidic residues; 117..130; Polar residues

Region

1..146; Disordered; 179..222; Induces experimental autoimmune encephalomyelitis (EAE) 1; 180..249; Disordered; 246..256; Induces experimental autoimmune encephalomyelitis (EAE) 2

Protein Families

Myelin basic protein family

Sequence Similarities

Belongs to the myelin basic protein family.

Clinical Relevance

Disease Involvement

Autoimmune encephalomyelitis

Related Diseases (2)

Autoimmune encephalomyelitis Multiple sclerosis

Biomarker

Phase 2

Drug Targets

Clinical trial target

Drugs (7)

BIOFLAVONOID INSULIN, REGULAR, HUMAN TIPLIMOTIDE PREDNISONE INTERFERON BETA-1A CYCLOSPORINE QUERCETIN

Antibody (3)

CAB002300 HPA049222 HPA064368

Interaction Protein (4)

ENSG00000144579ENSG00000163823ENSG00000169252ENSG00000169403

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Related sentences
32396726	Plasma-Derived Extracellular Vesicle Phosphoproteomics through Chemical Affinity Purification.	No related sentences available