Protein detail
MBP
Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)
Entry name MBP | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count | Protein classification Candidate cardiovascular disease genesDisease related genesPlasma proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)
Protein Class
Candidate cardiovascular disease genesDisease related genesPlasma proteinsPredicted intracellular proteins
Protein Function
- Candidate cardiovascular disease genes
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Description
Myelin basic protein
Chromosome
18
Position
76978827-77133683
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificgallbladderCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificamygdala excitatory
Function & Pathway
Protein Function
- Candidate cardiovascular disease genes
- Disease related genes
- Predicted intracellular proteins
Cellular Component
Molecular Function
Reactome
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
57 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| MBP | PRKCA | P17252 | S | 190 | phosphorylation | MIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | SIGNOR:2413024KEA:2413024ProtMapper:2413024 |
| MBP | PRKCA | P17252 | S | 116 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 122 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 13 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 133 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 142 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 152 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 159 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 162 | phosphorylation | KEA | KEA:2413024 |
| MBP | PRKCA | P17252 | S | 167 | phosphorylation | KEA | KEA:2413024 |
Ligand-Receptor Signaling
9 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
7 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | MBP | P02686 | Yes | Yes | No | WangPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDCui2007HINTKEACA1PhosphoSite_KEAHPRD_KEASIGNOR_ProtMapper | HINT:8375396CA1:10460230HPRD:2413024KEA:2413024ProtMapper:2413024SIGNOR:2413024HINT:15927069 |
| KAPCA | P17612 | MBP | P02686 | Yes | No | No | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | SIGNOR:2413024KEA:2413024HPRD:2413024ProtMapper:2413024 |
| CN37 | P09543 | MBP | P02686 | Yes | No | Yes | SIGNOR | SIGNOR:28076777 |
| MK01 | P28482 | MBP | P02686 | Yes | No | Yes | HPRD_MIMPSIGNORProtMapperHINTPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEABioGRIDHPRD_KEAphosphoELMSIGNOR_ProtMapperSPIKE_LC | SIGNOR:12760422HINT:12588875SIGNOR:16401070HINT:12114318ProtMapper:12760422HPRD:15380617KEA:15380617BioGRID:11258664HINT:22778266ProtMapper:16401070HINT:10371216HINT:10958680BioGRID:12944901HPRD:12760422HINT:8846788HINT:11570821BioGRID:10371216HINT:10464310SPIKE_LC:17255944HINT:11258664HINT:17255944KEA:12760422phosphoELM:1939237HINT:10978313KEA:1939237HINT:17906618HINT:11983899ProtMapper:1939237HPRD:9792705HINT:12944901HINT:9596579HINT:14530346SIGNOR:1939237 |
| MK03 | P27361 | MBP | P02686 | Yes | No | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDHINTPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:16401070ProtMapper:1939237HINT:19910486phosphoELM:1939237SIGNOR:16401070HINT:21924351HPRD:10339476HINT:14530346KEA:1939237SIGNOR:1939237HINT:17906618HINT:11570821 |
| UHMK1 | Q8TAS1 | MBP | P02686 | Yes | No | Yes | phosphoELM_MIMPMIMPiPTMnetPhosphoPointSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapper | ProtMapper:10880969ProtMapper:16401070KEA:10880969SIGNOR:16401070phosphoELM:10880969SIGNOR:10880969 |
| KPCD1 | Q15139 | MBP | P02686 | Yes | Yes | No | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetWangPhosphoSite | PhosphoSite:17939756 |
Protein Complex Composition
61 records.
Sequence, Structure & Domains
Sequences
Length
304
Mass
33,117
Sequence
MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR
Alternative Products
Event=Alternative splicing; Named isoforms=6; Comment=Additional isoforms seem to exist.; Name=1; Synonyms=Golli-MBP1, HOG7; IsoId=P02686-1; Sequence=Displayed; Name=2; Synonyms=Golli-MBP2, HOG5; IsoId=P02686-2; Sequence=VSP_003311; Name=3; Synonyms=MBP1, 21.5 kDa; IsoId=P02686-3; Sequence=VSP_003308, VSP_003309; Name=4; Synonyms=MBP2, 20.2 kDa; IsoId=P02686-4; Sequence=VSP_003308, VSP_003309, VSP_003310; Name=5; Synonyms=MBP3, 18.5 kDa; IsoId=P02686-5; Sequence=VSP_003308; Name=6; Synonyms=MBP4, 17.2 kDa; IsoId=P02686-6; Sequence=VSP_003308, VSP_003310
Alternative Sequence
1..133; Missing (in isoform 3, isoform 4, isoform 5 and isoform 6); 192; K -> KVPWLKPGRSPLPSHARSQPGLCNMYK (in isoform 3 and isoform 4); 193..304; DSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR -> VSSEE (in isoform 2); 240..250; Missing (in isoform 4 and isoform 6)
3D Structural Models
3D Structure
X-ray crystallography (6)
Domain & Motif Annotations
Compositional Bias
1..12; Basic and acidic residues; 22..32; Basic and acidic residues; 51..65; Polar residues; 95..113; Basic and acidic residues; 117..130; Polar residues
Region
1..146; Disordered; 179..222; Induces experimental autoimmune encephalomyelitis (EAE) 1; 180..249; Disordered; 246..256; Induces experimental autoimmune encephalomyelitis (EAE) 2
Protein Families
Myelin basic protein family
Sequence Similarities
Belongs to the myelin basic protein family.
Clinical Relevance
Disease Involvement
Autoimmune encephalomyelitis
Related Diseases
Biomarker
Phase 2
Drug Targets
Clinical trial target
Drugs
Interaction Protein
ENSG00000144579ENSG00000163823ENSG00000169252ENSG00000169403
Interaction Count
4
Interaction Dataset
intact_biogrid