Protein detail

MBP

Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)

Entry name MBP	UniProt ID P02686	EVMP confidence score 0.40
Supporting publications (n) 1	Transmembrane count	Protein classification Candidate cardiovascular disease genesDisease related genesPlasma proteinsPredicted intracellular proteins

Basic Information

Protein Names

Myelin basic protein (MBP) (Myelin A1 protein) (Myelin membrane encephalitogenic protein)

Protein Class (4)

Candidate cardiovascular disease genesDisease related genesPlasma proteinsPredicted intracellular proteins

Protein Function (3)

Candidate cardiovascular disease genes
Disease related genes
Predicted intracellular proteins

Ensembl

ENSG00000197971

Entrez Gene Symbol

MBP

Gene Description

Myelin basic protein

Chromosome

Position

76978827-77133683

Supporting publications (n)

EVMP confidence score

0.40

Fluorescence & Localization

Tissue SpecificgallbladderCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificamygdala excitatory

Function & Pathway

Protein Function (3)

Candidate cardiovascular disease genes
Disease related genes
Predicted intracellular proteins

Cellular Component (11)

Page 1 of 2

Molecular Function (5)

KEGG

hsa04517 IgSF CAM signaling

Reactome (2)

Mediation Categories (3)

Adhesion and uptake mediationClinical-translation mediationImmune mediation

Relations & Evidence135

Enzyme-Mediated Modification (57)

57 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
MBP	PRKACA	P17612	S	122	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	13	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	133	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	148	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	151	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	159	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	162	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	177	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	188	phosphorylation	KEA	KEA:2413024
MBP	PRKACA	P17612	S	57	phosphorylation	KEA	KEA:2413024

Page 3 of 6Previous Next

Ligand-Receptor Signaling (9)

9 records.

Category	Parent	Database	Transmitter	Receiver
intracellular	intracellular	LOCATE
intracellular	intracellular	ComPPI
intracellular	intracellular	GO_Intercell
intracellular	intracellular	OmniPath
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes
adhesion	adhesion	OmniPath	Yes	Yes
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes
plasma_membrane	plasma_membrane	Cellinker
plasma_membrane	plasma_membrane	OmniPath

Regulatory Interaction Network (7)

7 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KPCA	P17252	MBP	P02686	Yes	Yes		WangPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDCui2007HINTKEACA1PhosphoSite_KEAHPRD_KEASIGNOR_ProtMapper	HINT:8375396 CA1:10460230 HPRD:2413024 KEA:2413024 ProtMapper:2413024 SIGNOR:2413024 HINT:15927069
KAPCA	P17612	MBP	P02686	Yes			PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper	SIGNOR:2413024 KEA:2413024 HPRD:2413024 ProtMapper:2413024
CN37	P09543	MBP	P02686	Yes		Yes	SIGNOR	SIGNOR:28076777
MK01	P28482	MBP	P02686	Yes		Yes	HPRD_MIMPSIGNORProtMapperHINTPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEABioGRIDHPRD_KEAphosphoELMSIGNOR_ProtMapperSPIKE_LC	SIGNOR:12760422 HINT:12588875 SIGNOR:16401070 HINT:12114318 ProtMapper:12760422 HPRD:15380617 KEA:15380617 BioGRID:11258664 HINT:22778266 ProtMapper:16401070 HINT:10371216 HINT:10958680 BioGRID:12944901 HPRD:12760422 HINT:8846788 HINT:11570821 BioGRID:10371216 HINT:10464310 SPIKE_LC:17255944 HINT:11258664 HINT:17255944 KEA:12760422 phosphoELM:1939237 HINT:10978313 KEA:1939237 HINT:17906618 HINT:11983899 ProtMapper:1939237 HPRD:9792705 HINT:12944901 HINT:9596579 HINT:14530346 SIGNOR:1939237
MK03	P27361	MBP	P02686	Yes		Yes	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDHINTPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper	ProtMapper:16401070 ProtMapper:1939237 HINT:19910486 phosphoELM:1939237 SIGNOR:16401070 HINT:21924351 HPRD:10339476 HINT:14530346 KEA:1939237 SIGNOR:1939237 HINT:17906618 HINT:11570821
UHMK1	Q8TAS1	MBP	P02686	Yes		Yes	phosphoELM_MIMPMIMPiPTMnetPhosphoPointSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMSIGNOR_ProtMapper	ProtMapper:10880969 ProtMapper:16401070 KEA:10880969 SIGNOR:16401070 phosphoELM:10880969 SIGNOR:10880969
KPCD1	Q15139	MBP	P02686	Yes	Yes		PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetWangPhosphoSite	PhosphoSite:17939756

Protein Complex Composition (61)

61 records.

Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs
CDC45 MCM10 MCM2 MCM3 MCM4 MCM6 MCM7 MCMBP NUMA1 ORC3 ORC4 ORC5 ORC6 TIMM50	O43913 O43929 O75419 P25205 P33991 P33993 P49736 Q14566 Q14980 Q3ZCQ8 Q7L590 Q9BTE3 Q9UBD5 Q9Y5N6	1:1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC5741
CDC45 GINS4 MCM10 MCM2 MCM3 MCM4 MCM6 MCM7 MCMBP ORC2 ORC3 ORC4 ORC6	O43929 O75419 P25205 P33991 P33993 P49736 Q13416 Q14566 Q7L590 Q9BRT9 Q9BTE3 Q9UBD5 Q9Y5N6	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC3799
CDC45 GINS2 GINS4 MCM10 MCM2 MCM3 MCM4 MCM6 MCM7 MCMBP ORC2 ORC4	O43929 O75419 P25205 P33991 P33993 P49736 Q13416 Q14566 Q7L590 Q9BRT9 Q9BTE3 Q9Y248	1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7188
CDC45 MCM10 MCM2 MCM3 MCM4 MCM6 MCM7 MCMBP NUMA1 ORC4 TIMM50	O43929 O75419 P25205 P33991 P33993 P49736 Q14566 Q14980 Q3ZCQ8 Q7L590 Q9BTE3	1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC7237
CDC45 MCM10 MCM2 MCM3 MCM4 MCM6 MCM7 MCMBP ORC4 ORC6	O43929 O75419 P25205 P33991 P33993 P49736 Q14566 Q7L590 Q9BTE3 Q9Y5N6	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4586
STAM2 STAMBP	O75886 O95630	1:1	PDB	PDB:5ixf
STAMBP	O95630	7	PDB	PDB:9le4PDB:3rzu
KAT2A STAMBP TAF10 TAF11 TAF12 TAF13 TAF2 TAF3 TAF4B TAF6 TAF7 TAF8 TBP	O95630 P20226 P49848 Q12962 Q15543 Q15544 Q15545 Q16514 Q5VWG9 Q6P1X5 Q7Z7C8 Q92750 Q92830	1:1:1:1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC4014
CLTCL1 STAMBP	O95630 P53675	0:0	hu.MAP2
CHMP3 HIKESHI STAMBP	O95630 Q53FT3 Q9Y3E7	0:0:0	hu.MAP2

Page 5 of 7Previous Next

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	R Sequencing	2	27894104 38321535

Sequence, Structure & Domains

Sequences

Length

304

Mass

33,117

Sequence

MGNHAGKRELNAEKASTNSETNRGESEKKRNLGELSRTTSEDNEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGAPKRGSGKDSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR

Alternative Products

Event=Alternative splicing; Named isoforms=6; Comment=Additional isoforms seem to exist.; Name=1; Synonyms=Golli-MBP1, HOG7; IsoId=P02686-1; Sequence=Displayed; Name=2; Synonyms=Golli-MBP2, HOG5; IsoId=P02686-2; Sequence=VSP_003311; Name=3; Synonyms=MBP1, 21.5 kDa; IsoId=P02686-3; Sequence=VSP_003308, VSP_003309; Name=4; Synonyms=MBP2, 20.2 kDa; IsoId=P02686-4; Sequence=VSP_003308, VSP_003309, VSP_003310; Name=5; Synonyms=MBP3, 18.5 kDa; IsoId=P02686-5; Sequence=VSP_003308; Name=6; Synonyms=MBP4, 17.2 kDa; IsoId=P02686-6; Sequence=VSP_003308, VSP_003310

Alternative Sequence

1..133; Missing (in isoform 3, isoform 4, isoform 5 and isoform 6); 192; K -> KVPWLKPGRSPLPSHARSQPGLCNMYK (in isoform 3 and isoform 4); 193..304; DSHHPARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQRPGFGYGGRASDYKSAHKGFKGVDAQGTLSKIFKLGGRDSRSGSPMARR -> VSSEE (in isoform 2); 240..250; Missing (in isoform 4 and isoform 6)

3D Structural Models

3D Structure

X-ray crystallography (6)

Domain & Motif Annotations

Compositional Bias

1..12; Basic and acidic residues; 22..32; Basic and acidic residues; 51..65; Polar residues; 95..113; Basic and acidic residues; 117..130; Polar residues

Region

1..146; Disordered; 179..222; Induces experimental autoimmune encephalomyelitis (EAE) 1; 180..249; Disordered; 246..256; Induces experimental autoimmune encephalomyelitis (EAE) 2

Protein Families

Myelin basic protein family

Sequence Similarities

Belongs to the myelin basic protein family.

Clinical Relevance

Disease Involvement

Autoimmune encephalomyelitis

Related Diseases (2)

Autoimmune encephalomyelitis Multiple sclerosis

Biomarker

Phase 2

Drug Targets

Clinical trial target

Drugs (7)

BIOFLAVONOID INSULIN, REGULAR, HUMAN TIPLIMOTIDE PREDNISONE INTERFERON BETA-1A CYCLOSPORINE QUERCETIN

Antibody (3)

CAB002300 HPA049222 HPA064368

Interaction Protein (4)

ENSG00000144579ENSG00000163823ENSG00000169252ENSG00000169403

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications1

PMID	Title	Related sentences
32396726	Plasma-Derived Extracellular Vesicle Phosphoproteomics through Chemical Affinity Purification.	No related sentences available