Protein detail
CYTB
Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)
Entry name CYTB | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 31 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)
Protein Class (5)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Predicted secreted proteins
Ensembl
Entrez Gene Symbol
Gene Description
Cystatin E/M
Chromosome
11
Position
66012008-66013505
Supporting publications (n)
31
EVMP confidence score
0.75
Function & Pathway5
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Predicted secreted proteins
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Immune mediation
Relations & Evidence15
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | HPA_secretome | No | No | Yes | No | No |
| secreted | secreted | OmniPath | No | No | Yes | No | No |
Page 2 of 2Previous
Protein Complex Composition (2)
Sequence, Structure & Domains9
Sequences
Length
98
Mass
11,140
Sequence
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
3D Structural Models
Helix
14..31
Beta Strand
39..58; 60..62; 64..74; 80..89
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
46..50; Secondary area of contact
Protein Families
Cystatin family
Sequence Similarities
Belongs to the cystatin family.
Clinical Relevance2
Supporting Publications31
| PMID | Title | Abstract |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No abstract available |
| 28590090 | Motile hepatocellular carcinoma cells preferentially secret sugar metabolism regulatory proteins via exosomes. | No abstract available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No abstract available |
| 29148239 | Metabolic Signature of Microvesicles from Umbilical Cord Mesenchymal Stem Cells of Preterm and Term Infants. | No abstract available |
| 30379855 | Harmonization of exosome isolation from culture supernatants for optimized proteomics analysis. | No abstract available |
| 30408591 | Portrait of blood-derived extracellular vesicles in patients with Parkinson's disease. | No abstract available |
| 30646616 | Preferential Localization of MUC1 Glycoprotein in Exosomes Secreted by Non-Small Cell Lung Carcinoma Cells. | THBS1, ANXA6, HIST1H4A, COL18A1, MDK, SRGN, ENO1, TUBA4A, SLC3A2, GPI, MIF, MUC1, TALDO1, SLC7A5, ICAM1, HSP90AA1, G6PD, and LRP1 were found to be expressed in exosomes at more than 5-fold higher level as compared to total cellular membrane proteins. |
| 30950185 | Unique Protein Profiles of Extracellular Vesicles as Diagnostic Biomarkers for Early and Advanced Non-Small Cell Lung Cancer. | No abstract available |
| 31196968 | Cancer Cell Derived Small Extracellular Vesicles Contribute to Recipient Cell Metastasis Through Promoting HGF/c-Met Pathway. | No abstract available |
| 31941606 | The role of actinin-4 (ACTN4) in exosomes as a potential novel therapeutic target in castration-resistant prostate cancer. | No abstract available |
Page 1 of 4Next