Protein detail
CYTB
Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)
Entry name CYTB | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 31 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)
Protein Class (5)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Predicted secreted proteins
Ensembl
Entrez Gene Symbol
Gene Description
Cystatin E/M
Chromosome
11
Position
66012008-66013505
Supporting publications (n)
31
EVMP confidence score
0.88
Function & Pathway
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Predicted secreted proteins
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Immune mediation
Relations & Evidence15
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| secreted | secreted | HPA_secretome | Yes | ||||
| secreted | secreted | OmniPath | Yes |
Page 2 of 2Previous
Protein Complex Composition (2)
Sequence, Structure & Domains
Sequences
Length
98
Mass
11,140
Sequence
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
3D Structural Models
Helix
14..31
Beta Strand
39..58; 60..62; 64..74; 80..89
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
46..50; Secondary area of contact
Protein Families
Cystatin family
Sequence Similarities
Belongs to the cystatin family.
Clinical Relevance
Disease Involvement (3)
Cancer-related genesDisease variantEctodermal dysplasia
Related Diseases
Supporting Publications31
| PMID | Title | Related sentences |
|---|---|---|
| 36797805 | Magnetic transferrin nanoparticles (MTNs) assay as a novel isolation approach for exosomal biomarkers in neurological diseases. | No related sentences available |
| 37205098 | Proteomic profiling of extracellular vesicles in synovial fluid and plasma from Oligoarticular Juvenile Idiopathic Arthritis patients reveals novel immunopathogenic biomarkers. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39558134 | Serum small extracellular vesicles-derived BST2 as a biomarker for papillary thyroid microcarcinoma promotes lymph node metastasis. | No related sentences available |
| 39569406 | Proteomics of circulating extracellular vesicles reveals diverse clinical presentations of COVID-19 but fails to identify viral peptides. | No related sentences available |
| 39766158 | A Proteomic Examination of Plasma Extracellular Vesicles Across Colorectal Cancer Stages Uncovers Biological Insights That Potentially Improve Prognosis. | No related sentences available |
| 39940923 | NHERF2 as a Novel Biomarker for Distinguishing MAC Pulmonary Disease from Tuberculosis Based on Proteome Analysis of Serum Extracellular Vesicles. | No related sentences available |
| 40089067 | Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells. | No related sentences available |