Protein detail
CYTB
Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)
Entry name CYTB | UniProt ID | EVMP confidence score 0.75 |
Supporting publications (n) 31 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)
Protein Class (5)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Predicted secreted proteins
Ensembl
Entrez Gene Symbol
Gene Description
Cystatin E/M
Chromosome
11
Position
66012008-66013505
Supporting publications (n)
31
EVMP confidence score
0.75
Function & Pathway5
Protein Function (4)
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Congenital malformations:Congenital malformations of skin
- Predicted secreted proteins
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories
Immune mediation
Relations & Evidence15
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | LOCATE | No | No | Yes | No | No |
| extracellular | extracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| ecm_regulator | ecm_regulator | Matrisome | Yes | No | Yes | No | No |
| ecm_regulator | ecm_regulator | OmniPath | Yes | No | Yes | No | No |
| cystatin | secreted_peptidase_inhibitor | Matrisome | No | No | Yes | No | No |
| secreted_peptidase_inhibitor | secreted_peptidase_inhibitor | OmniPath | No | No | Yes | No | No |
| secreted | secreted | UniProt_keyword | No | No | Yes | No | No |
| secreted | secreted | UniProt_location | No | No | Yes | No | No |
Page 1 of 2Next
Protein Complex Composition (2)
Sequence, Structure & Domains9
Sequences
Length
98
Mass
11,140
Sequence
MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF
3D Structural Models
Helix
14..31
Beta Strand
39..58; 60..62; 64..74; 80..89
3D Structure
X-ray crystallography (3)
Domain & Motif Annotations
Motif
46..50; Secondary area of contact
Protein Families
Cystatin family
Sequence Similarities
Belongs to the cystatin family.
Clinical Relevance2
Supporting Publications31
| PMID | Title | Abstract |
|---|---|---|
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No abstract available |
| 32284825 | Unravelling the proteomic landscape of extracellular vesicles in prostate cancer by density-based fractionation of urine. | No abstract available |
| 32295833 | Dysregulation of Exosome Cargo by Mutant Tau Expressed in Human-induced Pluripotent Stem Cell (iPSC) Neurons Revealed by Proteomics Analyses. | Notably, mTau exosomes (not control exosomes) contain ANP32A (also known as I1PP2A), an endogenous inhibitor of the PP2A phosphatase which regulates the phosphorylation state of p-Tau. |
| 32489530 | Quantitative proteomic analysis of trypsin-treated extracellular vesicles to identify the real-vesicular proteins. | No abstract available |
| 33204424 | Proteomic analysis of extracellular vesicles reveals an immunogenic cargo in rheumatoid arthritis synovial fluid. | No abstract available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No abstract available |
| 34623918 | Metabolic responsiveness to training depends on insulin sensitivity and protein content of exosomes in insulin-resistant males. | No abstract available |
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No abstract available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No abstract available |
| 36398564 | Differential ultracentrifugation enables deep plasma proteomics through enrichment of extracellular vesicles. | No abstract available |