Protein detail

CYTB

Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)

Entry name CYTB	UniProt ID P04080	EVMP confidence score 0.75
Supporting publications (n) 31	Transmembrane count	Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information10

Protein Names

Cystatin-B (CPI-B) (Liver thiol proteinase inhibitor) (Stefin-B)

Protein Class (5)

Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted secreted proteins

Protein Function (4)

Disease related genes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Predicted secreted proteins

Ensembl

ENSG00000175315

Entrez Gene Symbol

CST6

Gene Description

Cystatin E/M

Chromosome

Position

66012008-66013505

Supporting publications (n)

EVMP confidence score

0.75

Function & Pathway5

Protein Function (4)

Disease related genes
Cancer-related genes:Candidate cancer biomarkers
Human disease related genes:Congenital malformations:Congenital malformations of skin
Predicted secreted proteins

Cellular Component (2)

Molecular Function (2)

Biological Process (3)

Mediation Categories

Immune mediation

Relations & Evidence15

Ligand-Receptor Signaling (12)

12 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
extracellular	extracellular	LOCATE	No	No	Yes	No	No
extracellular	extracellular	OmniPath	No	No	Yes	No	No
intracellular	intracellular	ComPPI	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
ecm_regulator	ecm_regulator	Matrisome	Yes	No	Yes	No	No
ecm_regulator	ecm_regulator	OmniPath	Yes	No	Yes	No	No
cystatin	secreted_peptidase_inhibitor	Matrisome	No	No	Yes	No	No
secreted_peptidase_inhibitor	secreted_peptidase_inhibitor	OmniPath	No	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No

Page 1 of 2Next

Protein Complex Composition (2)

2 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	CST6	Q15828	2	PDB	PDB:4n6mPDB:6fk0
	CST6 LGMN	Q15828 Q99538	1:1	PDB	PDB:4n6nPDB:4n6o

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationUltrafiltration / Tangential Flow FiltrationSize Exclusion Chromatography	Mass spectrometry	2	38576002 38795909

Sequence, Structure & Domains9

Sequences

Length

Mass

11,140

Sequence

MMCGAPSATQPATAETQHIADQVRSQLEEKENKKFPVFKAVSFKSQVVAGTNYFIKVHVGDEDFVHLRVFQSLPHENKPLTLSNYQTNKAKHDELTYF

3D Structural Models

Helix

14..31

Beta Strand

39..58; 60..62; 64..74; 80..89

3D Structure

X-ray crystallography (3)

Domain & Motif Annotations

Motif

46..50; Secondary area of contact

Protein Families

Cystatin family

Sequence Similarities

Belongs to the cystatin family.

Clinical Relevance2

Disease Involvement (3)

Cancer-related genesDisease variantEctodermal dysplasia

Antibody (2)

CAB019316 HPA044963

Supporting Publications31

PMID	Title	Abstract
40748658	Exosomes released from senescent cells and circulatory exosomes isolated from human plasma reveal aging-associated proteomic and lipid signatures.	No abstract available

Page 4 of 4Previous