Protein detail
HLAA
HLA class I histocompatibility antigen, A alpha chain (Human leukocyte antigen A) (HLA-A)
Entry name HLAA | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information8
Protein Names
HLA class I histocompatibility antigen, A alpha chain (Human leukocyte antigen A) (HLA-A)
Protein Function (8)
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Disease related genes
- Human disease related genes:Respiratory diseases:Tracheobronchial diseases
Transmembrane
309..332; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue Specificadipose tissueCell SpecificBreast lactating cellsSingle-Nuclei Brain Specificcerebellar inhibitory
Function & Pathway8
Protein Function (8)
- Cancer-related genes:Mutational cancer driver genes
- Transporters
- Predicted intracellular proteins
- Cancer-related genes:Mutated cancer genes
- Potential drug targets
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
- Disease related genes
- Human disease related genes:Respiratory diseases:Tracheobronchial diseases
Cellular Component (19)
- GO:0000139 Golgi membrane
- GO:0005615 extracellular space
- GO:0005783 endoplasmic reticulum
- GO:0005789 endoplasmic reticulum membrane
- GO:0005794 Golgi apparatus
- GO:0005797 Golgi medial cisterna
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
Page 1 of 2
Molecular Function (9)
Biological Process (3)
KEGG (19)
- hsa04144 Endocytosis
- KEGG:hsa04145 Phagosome
- KEGG:hsa04218 Cellular senescence
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
Page 1 of 2
Reactome (24)
- R-hsa-1280218 adaptive immune system
- R-hsa-983170 antigen presentation folding assembly and peptide loading of class i mhc
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-8866654 e3 ubiquitin ligases ubiquitinate target proteins
- R-hsa-1236977 endosomal vacuolar pathway
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
Page 1 of 3
Canonical Pathways
M195 Pid cmyb pathway
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence59
Enzyme-Mediated Modification (4)
4 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| HLA-A | SRC | P12931 | Y | 344 | phosphorylation | SIGNORProtMapperphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:6304688ProtMapper:6304688SIGNOR:6304688 |
| HLA-A | PRKACA | P17612 | S | 337 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| HLA-A | PRKACA | P17612 | S | 343 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| HLA-A | PRKCA | P17252 | S | 359 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:2941417 |
Ligand-Receptor Signaling (47)
47 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | Baccin2019 | No | No | No | Yes | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | HLAA | P04439 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDSIGNOR_ProtMapperHPRD-phos | ProtMapper:2941417HPRD-phos:2941417SIGNOR:2941417HPRD:2941417 |
| SRC | P12931 | HLAA | P04439 | Yes | No | No | BEL-Large-Corpus_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | phosphoELM:6304688HPRD:6304688ProtMapper:15212693ProtMapper:6304688ProtMapper:6333425HPRD:6333425SIGNOR:6304688 |
| KAPCA | P17612 | HLAA | P04439 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:6333425 |
Protein Complex Composition (4)
Sequence, Structure & Domains14
Sequences
Length
365
Mass
40,841
Sequence
MAVMAPRTLLLLLSGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEAGSHTIQIMYGCDVGSDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHEAEQLRAYLDGTCVEWLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPIVGIIAGLVLLGAVITGAVVAAVMWRRKSSDRKGGSYTQAASSDSAQGSDVSLTACKV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P04439-1; Sequence=Displayed; Name=2; IsoId=P04439-2; Sequence=VSP_060391, VSP_060392
Alternative Sequence
176..187; EAEQLRAYLDGT -> AAEQQRAYLEGR (in isoform 2); 337; S -> SGGEGVK (in isoform 2)
3D Structural Models
Helix
74..78; 81..108; 162..173; 176..184; 187..198; 200..203; 249..251; 278..280
Beta Strand
27..36; 41..43; 45..52; 55..61; 64..66; 70..73; 113..115; 118..127; 131..142; 145..150; 152..155; 157..159; 210..235; 238..243; 246..248; 252..254; 261..263; 265..274; 275..277; 281..286; 290..292; 294..297; 348..350
3D Structure
Electron microscopy (19); NMR spectroscopy (1); X-ray crystallography (374)
Domain & Motif Annotations
Compositional Bias
346..359; Low complexity
Domain (CC)
The alpha-1 domain is a structural part of the peptide-binding cleft.; DOMAIN: The alpha-2 domain is a structural part of the peptide-binding cleft (PubMed:19177349, PubMed:19542454, PubMed:20619457, PubMed:20844028, PubMed:21543847, PubMed:21943705, PubMed:22245737, PubMed:24395804, PubMed:26758806, PubMed:2784196, PubMed:28250417, PubMed:7694806, PubMed:8906788). Mediates the interaction with TAP1-TAP2 complex (PubMed:8805302).; DOMAIN: The alpha-3 Ig-like domain mediates the interaction with CD8 coreceptor.; DOMAIN: The VL9 peptide/epitope (VMAPRT[V/L][L/V/I/F]L) derived from the signal sequence is loaded onto HLA-E and enables HLA-E expression at the plasma membrane. Distinct VL9 peptides presented by HLA-E variably affect its recognition by KLRD1-KLRC1 or KLRD1-KLRC2 receptors on NK cells, setting NK cell activation threshold. Common HLA-A allotypes contain functional VL9 peptides (VMAPRTLLL, VMAPRTLVL and VPAPRTLLL).
Domain (FT)
209..295; Ig-like C1-type
Region
3..11; VL9 epitope; 25..114; Alpha-1; 115..206; Alpha-2; 207..298; Alpha-3; 299..308; Connecting peptide; 339..365; Disordered
Protein Families
MHC class I family
Sequence Similarities
Belongs to the MHC class I family.
Clinical Relevance7
Related Diseases
Biomarker
Phase 1
Drug Targets
Clinical trial target
Drugs (28)
FLOXACILLINTICLOPIDINEIPILIMUMABTETANUS ANTITOXINCARBAMAZEPINEAMPICILLIN (ANHYDROUS)RIBAVIRINFENOFIBRATE MICRONIZEDCLAVULANIC ACIDBACAMPICILLINAMOXICILLIN ANHYDROUSTEBENTAFUSPTHERAPEUTIC GLUCOCORTICOIDPEGINTERFERON ALFA-2BLEVETIRACETAMPEGINTERFERON ALFA-2ALAPATINIBCOBALTTRIMIPRAMINEVANCOMYCINDOXEPIN HYDROCHLORIDEMONOAMINE OXIDASE INHIBITORDESIPRAMINEDAPSONEZONISAMIDETERBINAFINECLOMIPRAMINEPOLYVALENT MELANOMA VACCINE
Interaction Protein (2)
ENSG00000166710ENSG00000204525
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 30915084 | Extracellular Vesicles Mediate Mesenchymal Stromal Cell-Dependent Regulation of B Cell PI3K-AKT Signaling Pathway and Actin Cytoskeleton. | No abstract available |
| 38014595 | Proteome and immune responses of extracellular vesicles derived from macrophages infected with the periodontal pathogen Tannerella forsythia. | No abstract available |