Protein detail
DPB1
HLA class II histocompatibility antigen, DP beta 1 chain (HLA class II histocompatibility antigen, DP(W4) beta chain) (MHC class II antigen DPB1)
Protein symbol DPB1 | UniProt ID | EVMP score 0.25 |
Frequency 1 | Transmembrane count 1 | Protein classification Human disease related genesPredicted membrane proteins |
Basic Information
Protein Names
HLA class II histocompatibility antigen, DP beta 1 chain (HLA class II histocompatibility antigen, DP(W4) beta chain) (MHC class II antigen DPB1)
Protein Class
Human disease related genesPredicted membrane proteins
Protein Function
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
Transmembrane
226..246; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
HLA-DP1B
Gene Description
Major histocompatibility complex, class II, DP beta 1
Chromosome
6
Position
33075990-33089696
Frequency
1
EVMP Score
0.25
Fluorescence & Localization
Cell SpecificAstrocytesSingle-Nuclei Brain SpecificastrocyteSecretome LocationIntracellular and membraneSecretome FunctionReceptor
Function & Pathway
Protein Function
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
- Human disease related genes:Cardiovascular diseases:Cardiac diseases
- Human disease related genes:Skin diseases:Skin and soft tissue diseases
Cellular Component
- GO:0000139 Golgi membrane
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0009986 cell surface
- GO:0012507 ER to Golgi transport vesicle membrane
- GO:0016020 membrane
- GO:0030658 transport vesicle membrane
- GO:0030666 endocytic vesicle membrane
- GO:0030669 clathrin-coated endocytic vesicle membrane
- GO:0031902 late endosome membrane
- GO:0032588 trans-Golgi network membrane
- GO:0042613 MHC class II protein complex
- GO:0098553 lumenal side of endoplasmic reticulum membrane
Molecular Function
Biological Process
KEGG
- hsa04145 Phagosome
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04612 Antigen processing and presentation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
- KEGG:hsa05150 Staphylococcus aureus infection
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05164 Influenza A
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05168 Herpes simplex virus 1 infection
- KEGG:hsa05169 Epstein-Barr virus infection
- KEGG:hsa05310 Asthma
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05321 Inflammatory bowel disease
- KEGG:hsa05322 Systemic lupus erythematosus
- KEGG:hsa05323 Rheumatoid arthritis
- KEGG:hsa05330 Allograft rejection
- KEGG:hsa05332 Graft-versus-host disease
- KEGG:hsa05416 Viral myocarditis
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-877300 interferon gamma signaling
- R-hsa-913531 interferon signaling
- R-hsa-2132295 mhc class ii antigen presentation
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-202403 tcr signaling
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
33 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_location | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | Yes | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | No | No | No | Yes | No |
Regulatory Interaction Network
0 records.
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| Class II MHC | HLA-DOAHLA-DPB1 | P04440P06340 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC | HLA-DMAHLA-DPB1 | P04440P28067 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C428 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DOAHLA-DPB1 | CHEBI:166824CHEBI:53000P04440P06340 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 | |
| Class II MHC:Antigen | CHEBI:166824CHEBI:53000HLA-DMAHLA-DPB1 | CHEBI:166824CHEBI:53000P04440P28067 | 0:0:0:0 | SIGNOR | SIGNOR:SIGNOR-C429 |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationUltrafiltration / Tangential Flow Filtration | Mass spectrometryR Sequencing | 1 | 32141557 |
Sequence, Structure & Domains
Sequences
Length
258
Mass
29,159
Sequence
MMVLQVSAAPRTVALTALLMVLLTSVVQGRATPENYLFQGRQECYAFNGTQRFLERYIYNREEFARFDSDVGEFRAVTELGRPAAEYWNSQKDILEEKRAVPDRMCRHNYELGGPMTLQRRVQPRVNVSPSKKGPLQHHNLLVCHVTDFYPGSIQVRWFLNGQEETAGVVSTNLIRNGDWTFQILVMLEMTPQQGDVYTCQVEHTSLDSPVTVEWKAQSDSARSKTLTGAGGFVLGLIICGVGIFMHRRSKKVQRGSA
3D Structural Models
Turn
69..71; 100..104
Helix
79..81; 82..89; 92..99; 105..112; 114..118; 134..137
Beta Strand
37..47; 50..59; 62..68; 73..78; 125..130; 141..152; 155..160; 163..165; 167..171; 178..180; 182..189; 197..203; 211..216
3D Structure
X-ray crystallography (10)
Domain & Motif Annotations
Domain (FT)
124..212; Ig-like C1-type
Region
30..121; Beta-1; 122..215; Beta-2; 216..225; Connecting peptide
Protein Families
MHC class II family
Sequence Similarities
Belongs to the MHC class II family.