Protein detail
HSPB1
Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Heat shock protein family B member 1) (Stress-responsive protein 27) (SRP27)
Entry name HSPB1 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Heat shock protein beta-1 (HspB1) (28 kDa heat shock protein) (Estrogen-regulated 24 kDa protein) (Heat shock 27 kDa protein) (HSP 27) (Heat shock protein family B member 1) (Stress-responsive protein 27) (SRP27)
Protein Class (5)
Cancer-related genesDisease related genesHuman disease related genesPlasma proteinsPredicted intracellular proteins
Protein Function (4)
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CMT2FHs.76067Hsp25HSP27HSP28
Gene Description
Heat shock protein family B (small) member 1
Chromosome
7
Position
76302673-76304295
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization5
Tissue SpecificintestineBrain Regional SpecificcerebellumCell SpecificLate spermatidsSingle-Nuclei Brain Specificupper rhombic lip
Function & Pathway7
Protein Function (4)
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Disease related genes
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Cellular Component (12)
- GO:0000502 proteasome complex
- GO:0001533 cornified envelope
- GO:0005615 extracellular space
- GO:0005634 nucleus
- GO:0005737 cytoplasm
- GO:0005819 spindle
- GO:0005829 cytosol
- GO:0005856 cytoskeleton
- GO:0005925 focal adhesion
- GO:0030018 Z disc
Page 1 of 2
Molecular Function (11)
- GO:0003723 RNA binding
- GO:0005080 protein kinase C binding
- GO:0005515 protein binding
- GO:0008426 protein kinase C inhibitor activity
- GO:0019901 protein kinase binding
- GO:0042802 identical protein binding
- GO:0042803 protein homodimerization activity
- GO:0043130 ubiquitin binding
- GO:0044183 protein folding chaperone
- GO:0051082 unfolded protein binding
Page 1 of 2
Biological Process (3)
Reactome (16)
- R-hsa-3371568 attenuation phase
- R-hsa-450408 auf1 hnrnp d0 binds and destabilizes mrna
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-3371556 cellular response to heat stress
- R-hsa-8939211 esr mediated signaling
- R-hsa-9009391 extra nuclear estrogen signaling
- R-hsa-3371511 hsf1 activation
- R-hsa-3371571 hsf1 dependent transactivation
- R-hsa-5687128 mapk6 mapk4 signaling
- R-hsa-5683057 mapk family signaling cascades
Page 1 of 2
Mediation Categories (3)
Adhesion and uptake mediationImmune mediationReceptor-signaling mediation
Relations & Evidence106
Enzyme-Mediated Modification (76)
76 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| HSPB1 | MAP2K6 | P52564 | S | 78 | phosphorylation | REACH_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:28460458 |
| HSPB1 | MAP2K6 | P52564 | S | 15 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:28460458 |
| HSPB1 | NLK | Q9UBE8 | S | 82 | phosphorylation | RLIMS-P_ProtMapperSparser_ProtMapperProtMapper | ProtMapper:24816797 |
| HSPB1 | MAPK13 | O15264 | S | 82 | phosphorylation | Sparser_ProtMapperProtMapper | |
| HSPB1 | MAPK13 | O15264 | S | 78 | phosphorylation | Sparser_ProtMapperProtMapper | |
| HSPB1 | GPI | P06744 | S | 82 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:24816797 |
| HSPB1 | PRKCD | Q05655 | S | 82 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:22974980ProtMapper:21492875 |
| HSPB1 | PRKCD | Q05655 | S | 78 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:22974980 |
| HSPB1 | YRDC | Q86U90 | S | 82 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:26329039 |
| HSPB1 | F2 | P00734 | S | 82 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:1730670 |
Ligand-Receptor Signaling (8)
8 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ecm | ecm | MatrixDB | Yes | No | No | No | No |
| ecm | ecm | OmniPath | Yes | No | No | No | No |
| extracellular | extracellular | OmniPath | No | No | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (11)
11 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| HSPB1 | P04792 | GCH1 | P30793 | Yes | Yes | No | SIGNOR | SIGNOR:18241680 |
Page 2 of 2Previous
Protein Complex Composition (10)
10 records.
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38014595 |
Sequence, Structure & Domains11
Sequences
Length
205
Mass
22,783
Sequence
MTERRVPFSLLRGPSWDPFRDWYPHSRLFDQAFGLPRLPEEWSQWLGGSSWPGYVRPLPPAAIESPAVAAPAYSRALSRQLSSGVSEIRHTADRWRVSLDVNHFAPDELTVKTKDGVVEITGKHEERQDEHGYISRCFTRKYTLPPGVDPTQVSSSLSPEGTLTVEAPMPKLATQSNEITIPVTFESRAQLGGPEAAKSDETAAK
3D Structural Models
Turn
102..104; 145..147
Helix
150..152
Beta Strand
86..88; 94..100; 107..114; 117..124; 136..143; 154..157; 161..168
3D Structure
NMR spectroscopy (1); X-ray crystallography (5)
Domain & Motif Annotations
Domain (FT)
76..184; sHSP
Region
70..205; Interaction with TGFB1I1
Protein Families
Small heat shock protein (HSP20) family
Sequence Similarities
Belongs to the small heat shock protein (HSP20) family.
Clinical Relevance6
Disease Involvement (5)
Cancer-related genesCharcot-Marie-Tooth diseaseDisease variantNeurodegenerationNeuropathy
Drugs (36)
GUGGULSTERONEAPATORSENRHAMNETINFEPRAZONETRIAMTERENEDIFFERENTIATION INDUCERALPHA-TERTHIENYLOMEPRAZOLENOCODAZOLEASCORBIC ACIDBENZO(K)FLUORANTHENEROFECOXIBZEARALENONEHYMECROMONECHEMBL:CHEMBL2094499ARGIPRESSINBUFOTENINETYROSINE KINASE INHIBITORCRIDANIMODTEROXIRONECHEMBL:CHEMBL1935538HYDRASTININE HYDROCHLORIDE1,10-PHENANTHROLINEQUERCETINCLOXYQUINALBENDAZOLEUREACYCLOFENILDICARBONODITHIOIMIDIC DIAMIDECHEMBL:CHEMBL333177CHEMBL:CHEMBL2332783BENZENETHIOLMOMETASONECYROMAZINETHERAPEUTIC ESTROGENPROTEIN KINASE C INHIBITOR
Interaction Protein (30)
ENSG00000004478ENSG00000006712ENSG00000079246ENSG00000086758ENSG00000089289ENSG00000100603ENSG00000100614ENSG00000106723ENSG00000108883ENSG00000109846ENSG00000110321ENSG00000114416ENSG00000114738ENSG00000133112ENSG00000141510ENSG00000148834ENSG00000151929ENSG00000152137ENSG00000156976ENSG00000160049ENSG00000160202ENSG00000162889ENSG00000165280ENSG00000166333ENSG00000167996ENSG00000169299ENSG00000179218ENSG00000183431ENSG00000196549ENSG00000204209
Interaction Count
30
Interaction Dataset (2)
intact_biogridintact_biogrid_bioplex
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 32384937 | Alzheimer's disease progression characterized by alterations in the molecular profiles and biogenesis of brain extracellular vesicles. | No abstract available |