Protein detail
AT1A1
Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1)
Protein symbol AT1A1 | UniProt ID | EVMP score 0.50 |
Frequency 1 | Transmembrane count 10 | Protein classification Cancer-related genesDisease related genesEnzymesEssential proteinsFDA approved drug targetsHuman disease related genesMetabolic proteinsPlasma proteinsPredicted membrane proteinsTransporters |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Sodium/potassium-transporting ATPase subunit alpha-1 (Na(+)/K(+) ATPase alpha-1 subunit) (EC 7.2.2.13) (Sodium pump subunit alpha-1)
Protein Class
Cancer-related genesDisease related genesEnzymesEssential proteinsFDA approved drug targetsHuman disease related genesMetabolic proteinsPlasma proteinsPredicted membrane proteinsTransporters
Protein Function
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Enzymes
- ENZYME proteins
- Transporters:Primary Active Transporters
- Cancer-related genes
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Endocrine and metabolic diseases:Adrenal gland diseases
Transmembrane
88..108; Helical; 132..152; Helical; 289..308; Helical; 321..338; Helical; 773..792; Helical; 803..823; Helical; 844..866; Helical; 919..938; Helical; 952..970; Helical; 986..1006; Helical
Transmembrane Count
10
Ensembl
Entrez Gene Symbol
Gene Description
ATPase Na+/K+ transporting subunit alpha 1
Chromosome
1
Position
116372668-116410261
Frequency
1
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificBasal keratinocytes
Function & Pathway
Protein Function
- Human disease related genes:Congenital disorders of metabolism:Other congenital disorders of metabolism
- Human disease related genes:Nervous system diseases:Neurodegenerative diseases
- Enzymes
- ENZYME proteins
- Transporters:Primary Active Transporters
- Cancer-related genes
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- Human disease related genes:Endocrine and metabolic diseases:Adrenal gland diseases
Cellular Component
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0005890 sodium:potassium-exchanging ATPase complex
- GO:0014069 postsynaptic density
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0030315 T-tubule
- GO:0030424 axon
- GO:0031090 organelle membrane
- GO:0032991 protein-containing complex
- GO:0036126 sperm flagellum
- GO:0042383 sarcolemma
- GO:0042470 melanosome
- GO:0045121 membrane raft
- GO:0060342 photoreceptor inner segment membrane
- GO:0070062 extracellular exosome
- GO:1903561 extracellular vesicle
Molecular Function
- GO:0005391 P-type sodium:potassium-exchanging transporter activity
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0016791 phosphatase activity
- GO:0016887 ATP hydrolysis activity
- GO:0030955 potassium ion binding
- GO:0031402 sodium ion binding
- GO:0044325 transmembrane transporter binding
- GO:0046982 protein heterodimerization activity
- GO:0051087 protein-folding chaperone binding
- GO:1990239 steroid hormone binding
Biological Process
KEGG
- hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04260 Cardiac muscle contraction
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa04911 Insulin secretion
- KEGG:hsa04918 Thyroid hormone synthesis
- KEGG:hsa04919 Thyroid hormone signaling pathway
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04960 Aldosterone-regulated sodium reabsorption
- KEGG:hsa04961 Endocrine and other factor-regulated calcium reabsorption
- KEGG:hsa04964 Proximal tubule bicarbonate reclamation
- KEGG:hsa04970 Salivary secretion
- KEGG:hsa04971 Gastric acid secretion
- KEGG:hsa04972 Pancreatic secretion
- KEGG:hsa04973 Carbohydrate digestion and absorption
- KEGG:hsa04974 Protein digestion and absorption
- KEGG:hsa04976 Bile secretion
- KEGG:hsa04978 Mineral absorption
Reactome
- R-hsa-5576891 cardiac conduction
- R-hsa-5663205 infectious disease
- R-hsa-983712 ion channel transport
- R-hsa-5578775 ion homeostasis
- R-hsa-936837 ion transport by p type atpases
- R-hsa-397014 muscle contraction
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-9679506 sars cov infections
- R-hsa-382551 transport of small molecules
- R-hsa-9824446 viral infection pathways
Mediation Categories
Clinical-translation mediationFusion and delivery mediation
Relations & Evidence
Enzyme-Mediated Modification
8 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ATP1A1 | PRKCZ | Q05513 | S | 16 | phosphorylation | SIGNOR | SIGNOR:12671055 |
| ATP1A1 | PRKCA | P17252 | S | 16 | phosphorylation | SIGNOR | SIGNOR:14976217 |
| ATP1A1 | MAPK1 | P28482 | S | 16 | phosphorylation | SIGNOR | SIGNOR:14976217 |
| ATP1A1 | PRKACA | P17612 | S | 943 | phosphorylation | PhosphoSite_MIMPMIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| ATP1A1 | SRC | P12931 | Y | 149 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| ATP1A1 | SRC | P12931 | Y | 260 | phosphorylation | PhosphoSite | |
| ATP1A1 | CSNK1A1 | P48729 | S | 16 | phosphorylation | KEA | KEA:17570479 |
| ATP1A1 | INSR | P06213 | Y | 10 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling
28 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| transporter | transporter | Surfaceome | No | Yes | No | Yes | No |
| sodium_potassium_atpase | transporter | HGNC | No | Yes | No | Yes | No |
| transporter | transporter | HGNC | No | Yes | No | Yes | No |
| p_atpase | transporter | Surfaceome | No | Yes | No | Yes | No |
Page 1 of 3Next
Regulatory Interaction Network
5 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCA | P17252 | AT1A1 | P05023 | Yes | No | Yes | SIGNORProtMapperKEASIGNOR_ProtMapperNetworKIN_KEA | KEA:17570479ProtMapper:14976217SIGNOR:14976217 |
| KPCZ | Q05513 | AT1A1 | P05023 | Yes | Yes | No | SIGNOR_ProtMapperiPTMnetSIGNORProtMapper | ProtMapper:12671055SIGNOR:12671055 |
| MK01 | P28482 | AT1A1 | P05023 | Yes | No | Yes | iPTMnetSIGNORProtMapperInnateDBSIGNOR_ProtMapper | ProtMapper:14976217InnateDB:15069082SIGNOR:14976217 |
| KAPCA | P17612 | AT1A1 | P05023 | Yes | No | No | PhosphoSite_MIMPMIMPiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:15972390 |
| SRC | P12931 | AT1A1 | P05023 | Yes | No | No | PhosphoSite_norefProtMapperHINTPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:30120256HINT:33961781HINT:21278788 |
Protein Complex Composition
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ATP1A1HGSMAPK1STAMTSG101UBC | O14964P05023P0CG48P28482Q92783Q99816 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC8910 | ||
| ARMT1ATP1A1AURKACKAP5TACC1TACC3 | O14965O75410P05023Q14008Q9H993Q9Y6A5 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7765 | ||
| ATP1A1SNX2SNX6SYAP1TPT1UBC | O60749P05023P0CG48P13693Q96A49Q9UNH7 | 1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6834 |
Sequence, Structure & Domains
Sequences
Length
1,023
Mass
112,896
Sequence
MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGFSMLLWIGAILCFLAYSIQAATEEEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINAEEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNIAFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFLGVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLEAVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALSRIAGLCNRAVFQANQENLPILKRAVAGDASESALLKCIELCCGSVKEMRERYAKIVEIPFNSTNKYQLSIHKNPNTSEPQHLLVMKGAPERILDRCSSILLHGKEQPLDEELKDAFQNAYLELGGLGERVLGFCHLFLPDEQFPEGFQFDTDDVNFPIDNLCFVGLISMIDPPRAAVPDAVGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDSPALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTSNIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPKTDKLVNERLISMAYGQIGMIQALGGFFTYFVILAENGFLPIHLLGLRVDWDDRWINDVEDSYGQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEETALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETYY
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=1; Synonyms=Long; IsoId=P05023-1; Sequence=Displayed; Name=2; Synonyms=Short; IsoId=P05023-2; Sequence=VSP_000415, VSP_000416; Name=3; IsoId=P05023-3; Sequence=VSP_044242; Name=4; IsoId=P05023-4; Sequence=VSP_047309
Alternative Sequence
1..31; Missing (in isoform 3); 2..4; GKG -> AFK (in isoform 4); 638..681; NETVEDIAARLNIPVSQVNPRDAKACVVHGSDLKDMTSEQLDDI -> SGPMSRGKSWSSPATQPSSSVSWWCSGPTWSSVRPGGIRSSSRG (in isoform 2); 682..1023; Missing (in isoform 2)
3D Structural Models
Turn
59..61; 353..355; 484..486; 515..517; 547..549; 740..744; 812..815; 880..885
Helix
31..34; 50..54; 65..75; 88..93; 95..97; 100..119; 128..149; 157..161; 182..184; 216..219; 262..264; 266..276; 283..305; 309..312; 317..329; 336..352; 363..366; 377..381; 416..427; 442..444; 451..463; 468..473; 511..514; 532..546; 599..608; 621..630; 641..647; 652..654; 668..671; 675..684; 695..707; 719..721; 722..727; 756..781; 784..795; 805..811; 816..820; 821..824; 831..833; 847..855; 857..876; 887..891; 908..936; 944..947; 952..970; 974..977; 985..989; 992..1011; 1016..1021
Beta Strand
35..37; 55..57; 122..124; 163..165; 171..173; 176..178; 190..194; 201..209; 211..214; 225..227; 240..243; 251..260; 356..360; 372..376; 387..391; 404..407; 447..449; 476..480; 488..493; 496..500; 502..509; 521..523; 526..528; 551..558; 562..564; 567..569; 573..575; 587..592; 612..616; 661..666; 686..692; 712..716; 728..737; 747..750; 839..842; 940..942
3D Structure
Electron microscopy (3)
Domain & Motif Annotations
Compositional Bias
1..11; Basic and acidic residues; 28..39; Basic and acidic residues
Region
1..39; Disordered; 82..84; Phosphoinositide-3 kinase binding; 216..235; Disordered; 596..717; Mediates interaction with SCN7A
Protein Families
- Cation transport ATPase (P-type) (TC 3.A.3) family
- Type IIC subfamily
Sequence Similarities
Belongs to the cation transport ATPase (P-type) (TC 3.A.3) family. Type IIC subfamily.
Clinical Relevance
Disease Involvement
Cancer-related genesCharcot-Marie-Tooth diseaseEpilepsyFDA approved drug targetsIntellectual disabilityNeurodegenerationNeuropathyPrimary hypomagnesemia
Related Diseases
Biomarker
Approved; Phase 1; Investigative
Drug Targets
FDA approved drug targets
Drugs
Interaction Protein
ENSG00000069849ENSG00000104419ENSG00000105409ENSG00000143153ENSG00000168003
Interaction Count
5
Interaction Dataset
biogrid_opencellintact_biogrid_opencellbiogrid_bioplex