Protein detail
AT1B1
Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1)
Entry name AT1B1 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 1 | Transmembrane count 1 | Protein classification Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Sodium/potassium-transporting ATPase subunit beta-1 (Sodium/potassium-dependent ATPase subunit beta-1)
Protein Class (4)
Metabolic proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (2)
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Transmembrane
35..62; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
ATP1B
Gene Description
ATPase Na+/K+ transporting subunit beta 1
Chromosome
1
Position
169105697-169310992
Supporting publications (n)
1
EVMP confidence score
0.40
Fluorescence & Localization
Cell SpecificAdrenal cortex cellsSingle-Nuclei Brain SpecificastrocyteBlood Cell SpecificneutrophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted to bloodSecretome FunctionReceptor
Function & Pathway
Protein Function (2)
- Transporters:Primary Active Transporters
- Predicted intracellular proteins
Cellular Component (13)
- GO:0005886 plasma membrane
- GO:0005890 sodium:potassium-exchanging ATPase complex
- GO:0014704 intercalated disc
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0016328 lateral plasma membrane
- GO:0030315 T-tubule
- GO:0031090 organelle membrane
- GO:0036126 sperm flagellum
Page 1 of 2
Molecular Function (8)
- GO:0001671 ATPase activator activity
- GO:0005391 P-type sodium:potassium-exchanging transporter activity
- GO:0005515 protein binding
- GO:0019901 protein kinase binding
- GO:0023026 MHC class II protein complex binding
- GO:0030674 protein-macromolecule adaptor activity
- GO:0046982 protein heterodimerization activity
- GO:0051117 ATPase binding
Biological Process (3)
KEGG (19)
- hsa04022 cGMP-PKG signaling pathway
- KEGG:hsa04024 cAMP signaling pathway
- KEGG:hsa04260 Cardiac muscle contraction
- KEGG:hsa04261 Adrenergic signaling in cardiomyocytes
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa04911 Insulin secretion
- KEGG:hsa04918 Thyroid hormone synthesis
- KEGG:hsa04919 Thyroid hormone signaling pathway
- KEGG:hsa04925 Aldosterone synthesis and secretion
- KEGG:hsa04960 Aldosterone-regulated sodium reabsorption
Page 1 of 2
Reactome (13)
- R-hsa-210991 basigin interactions
- R-hsa-5576891 cardiac conduction
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-109582 hemostasis
- R-hsa-5663205 infectious disease
- R-hsa-983712 ion channel transport
- R-hsa-5578775 ion homeostasis
- R-hsa-936837 ion transport by p type atpases
- R-hsa-397014 muscle contraction
- R-hsa-9679191 potential therapeutics for sars
Page 1 of 2
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence39
Ligand-Receptor Signaling (34)
34 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | LOCATE | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | ||
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | ||
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | ||
| transporter | transporter | Surfaceome | Yes | Yes | |||
| sodium_potassium_atpase | transporter | HGNC | Yes | Yes | |||
| transporter | transporter | HGNC | Yes | Yes |
Page 1 of 4Next
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| WFS1 | O76024 | AT1B1 | P05026 | Yes | Yes | SIGNOR | SIGNOR:17947299 | |
| RN183 | Q96D59 | AT1B1 | P05026 | Yes | Yes | SIGNOR | SIGNOR:31732153 |
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30550287 |
Sequence, Structure & Domains
Sequences
Length
303
Mass
35,061
Sequence
MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P05026-1; Sequence=Displayed; Name=2; IsoId=P05026-2; Sequence=VSP_000349
Alternative Sequence
300..303; EVKS -> KF (in isoform 2)
3D Structural Models
Turn
11..14; 19..22; 70..72; 95..98; 120..122; 165..172
Helix
29..59; 99..108; 109..112; 114..116; 153..159; 218..223; 240..242; 247..250
Beta Strand
23..25; 63..65; 76..81; 84..90; 139..145; 160..163; 175..180; 194..200; 208..217; 227..239; 259..263; 268..270; 272..278; 292..301
3D Structure
Electron microscopy (9)
Domain & Motif Annotations
Domain (CC)
The C-terminal lobe folds into an immunoglobulin-like domain and mediates cell adhesion properties.
Region
191..303; immunoglobulin-like
Protein Families
X(+)/potassium ATPases subunit beta family
Sequence Similarities
Belongs to the X(+)/potassium ATPases subunit beta family.
Clinical Relevance
Drugs (21)
Antibody
Interaction Protein (2)
ENSG00000144891ENSG00000163399
Interaction Count
2
Interaction Dataset (2)
intact_biogridintact_biogrid_opencell
Supporting Publications1
| PMID | Title | Related sentences |
|---|---|---|
| 31941606 | The role of actinin-4 (ACTN4) in exosomes as a potential novel therapeutic target in castration-resistant prostate cancer. | No related sentences available |