Protein detail
ITB1
Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)
Protein symbol ITB1 | UniProt ID | EVMP score 0.50 |
Frequency 3 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
Basic Information
Protein Names
Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)
Protein Class
Cancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function
- Transporters
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- FDA approved drug targets:Biotech drugs
Transmembrane
729..751; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD29FNRBGPIIAMDF2MSK12
Gene Description
Integrin subunit beta 1
Chromosome
10
Position
32887273-33005792
Frequency
3
EVMP Score
0.50
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway
Protein Function
- Transporters
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- FDA approved drug targets:Biotech drugs
Cellular Component
- GO:0001726 ruffle
- GO:0005737 cytoplasm
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0008305 integrin complex
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0010008 endosome membrane
- GO:0014704 intercalated disc
- GO:0016020 membrane
- GO:0030027 lamellipodium
- GO:0030175 filopodium
- GO:0031594 neuromuscular junction
- GO:0032154 cleavage furrow
- GO:0032587 ruffle membrane
- GO:0034665 integrin alpha1-beta1 complex
- GO:0034666 integrin alpha2-beta1 complex
- GO:0034667 integrin alpha3-beta1 complex
- GO:0034668 integrin alpha4-beta1 complex
- GO:0034674 integrin alpha5-beta1 complex
- GO:0034675 integrin alpha6-beta1 complex
- GO:0034677 integrin alpha7-beta1 complex
- GO:0034678 integrin alpha8-beta1 complex
- GO:0034679 integrin alpha9-beta1 complex
- GO:0034680 integrin alpha10-beta1 complex
- GO:0034681 integrin alpha11-beta1 complex
- GO:0034682 integrin alphav-beta1 complex
- GO:0035748 myelin sheath abaxonal region
- GO:0042383 sarcolemma
- GO:0042470 melanosome
- GO:0043197 dendritic spine
- GO:0043235 receptor complex
- GO:0045121 membrane raft
- GO:0045202 synapse
- GO:0048471 perinuclear region of cytoplasm
- GO:0055037 recycling endosome
- GO:0070062 extracellular exosome
- GO:0097060 synaptic membrane
- GO:0097386 glial cell projection
- GO:0098685 Schaffer collateral - CA1 synapse
- GO:0150053 cerebellar climbing fiber to Purkinje cell synapse
Molecular Function
- GO:0000287 magnesium ion binding
- GO:0001618 virus receptor activity
- GO:0001968 fibronectin binding
- GO:0002020 protease binding
- GO:0003779 actin binding
- GO:0005178 integrin binding
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0015026 coreceptor activity
- GO:0019901 protein kinase binding
- GO:0019960 C-X3-C chemokine binding
- GO:0043236 laminin binding
- GO:0044877 protein-containing complex binding
- GO:0045296 cadherin binding
- GO:0046982 protein heterodimerization activity
- GO:0050839 cell adhesion molecule binding
- GO:0098639 collagen binding involved in cell-matrix adhesion
- GO:0098640 integrin binding involved in cell-matrix adhesion
- GO:1990782 protein tyrosine kinase binding
Biological Process
KEGG
- hsa03271 Virion - Rotavirus
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04145 Phagosome
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04530 Tight junction
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04670 Leukocyte transendothelial migration
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa05100 Bacterial invasion of epithelial cells
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05133 Pertussis
- KEGG:hsa05135 Yersinia infection
- KEGG:hsa05140 Leishmaniasis
- KEGG:hsa05145 Toxoplasmosis
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05205 Proteoglycans in cancer
- KEGG:hsa05222 Small cell lung cancer
- KEGG:hsa05410 Hypertrophic cardiomyopathy
- KEGG:hsa05412 Arrhythmogenic right ventricular cardiomyopathy
- KEGG:hsa05414 Dilated cardiomyopathy
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-210991 basigin interactions
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1500931 cell cell communication
- R-hsa-446353 cell extracellular matrix interactions
- R-hsa-446728 cell junction organization
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-447041 chl1 interactions
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-9734767 developmental cell lineages
- R-hsa-9734779 developmental cell lineages of the integumentary system
- R-hsa-9924644 developmental lineages of the mammary gland
- R-hsa-9927418 developmental lineage of mammary gland luminal epithelial cells
- R-hsa-9927432 developmental lineage of mammary gland myoepithelial cells
- R-hsa-9938206 developmental lineage of mammary stem cells
- R-hsa-9725554 differentiation of keratinocytes in interfollicular epidermis in mammalian skin
- R-hsa-3000178 ecm proteoglycans
- R-hsa-1566948 elastic fibre formation
- R-hsa-1474244 extracellular matrix organization
- R-hsa-1566977 fibronectin matrix formation
- R-hsa-9830674 formation of the ureteric bud
- R-hsa-9634597 gper1 signaling
- R-hsa-418555 g alpha s signalling events
- R-hsa-9609690 hcmv early events
- R-hsa-9609646 hcmv infection
- R-hsa-109582 hemostasis
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-5663205 infectious disease
- R-hsa-216083 integrin cell surface interactions
- R-hsa-6785807 interleukin 4 and interleukin 13 signaling
- R-hsa-9830369 kidney development
- R-hsa-373760 l1cam interactions
- R-hsa-3000157 laminin interactions
- R-hsa-9856532 mechanical load activates signaling by piezo1 and integrins in osteocytes
- R-hsa-8874081 met activates ptk2 signaling
- R-hsa-8875513 met interacts with tns proteins
- R-hsa-8875878 met promotes cell motility
- R-hsa-2129379 molecules associated with elastic fibres
- R-hsa-9675108 nervous system development
- R-hsa-3000171 non integrin membrane ecm interactions
- R-hsa-416700 other semaphorin interactions
- R-hsa-75892 platelet adhesion to exposed collagen
- R-hsa-9679191 potential therapeutics for sars
- R-hsa-9013149 rac1 gtpase cycle
- R-hsa-9013404 rac2 gtpase cycle
- R-hsa-9013423 rac3 gtpase cycle
- R-hsa-9013408 rhog gtpase cycle
- R-hsa-5663220 rho gtpases activate formins
- R-hsa-9012999 rho gtpase cycle
- R-hsa-195258 rho gtpase effectors
- R-hsa-9679506 sars cov infections
- R-hsa-373755 semaphorin interactions
- R-hsa-372790 signaling by gpcr
- R-hsa-449147 signaling by interleukins
- R-hsa-6806834 signaling by met
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-9716542 signaling by rho gtpases miro gtpases and rhobtb3
- R-hsa-9006936 signaling by tgfb family members
- R-hsa-170834 signaling by tgf beta receptor complex
- R-hsa-445144 signal transduction by l1
- R-hsa-3000170 syndecan interactions
- R-hsa-2173789 tgf beta receptor signaling activates smads
- R-hsa-9860927 turbulent oscillatory disturbed flow shear stress activates signaling by piezo1 and integrins in endothelial cells
- R-hsa-9824446 viral infection pathways
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
17 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ITGB1 | PTPRG | P23470 | Y | 783 | dephosphorylation | SIGNOR | SIGNOR:25624455 |
| ITGB1 | PTPRG | P23470 | Y | 783 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:25624455 |
| ITGB1 | PPP2CA | P67775 | T | 788 | dephosphorylation | DEPOD | DEPOD:14660602DEPOD:10896784 |
| ITGB1 | PPP2CA | P67775 | T | 789 | dephosphorylation | DEPOD | DEPOD:14660602DEPOD:10896784 |
| ITGB1 | PPP2CB | P62714 | T | 788 | dephosphorylation | DEPOD | DEPOD:14660602DEPOD:10896784 |
| ITGB1 | PPP2CB | P62714 | T | 789 | dephosphorylation | DEPOD | DEPOD:14660602DEPOD:10896784 |
| ITGB1 | CAMK2A | Q9UQM7 | T | 788 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| ITGB1 | CAMK2A | Q9UQM7 | T | 789 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| ITGB1 | CAMK2B | Q13554 | T | 789 | phosphorylation | PhosphoSite | |
| ITGB1 | CAMK2B | Q13554 | T | 788 | phosphorylation | PhosphoSite |
Page 1 of 2Next
Ligand-Receptor Signaling
71 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_keyword | No | No | No | Yes | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | Yes | No |
| transmembrane | transmembrane | CellPhoneDB | No | No | No | Yes | No |
| transmembrane | transmembrane | TopDB | No | No | No | Yes | No |
| transmembrane | transmembrane | LOCATE | No | No | No | Yes | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | Yes | No |
| transmembrane | transmembrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | Cellinker | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
Regulatory Interaction Network
28 records.
Page 1 of 3Next
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38014595 |
Sequence, Structure & Domains
Sequences
Length
798
Mass
88,415
Sequence
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Beta-1A; IsoId=P05556-1; Sequence=Displayed; Name=2; Synonyms=Beta-1B; IsoId=P05556-2; Sequence=VSP_002741; Name=3; Synonyms=Beta-1C; IsoId=P05556-3; Sequence=VSP_002742; Name=4; Synonyms=Beta-1C-2; IsoId=P05556-4; Sequence=VSP_002743; Name=5; Synonyms=Beta-1D; IsoId=P05556-5; Sequence=VSP_002744
Alternative Sequence
778..798; GENPIYKSAVTTVVNPKYEGK -> VSYKTSKKQSGL (in isoform 2); 778..798; GENPIYKSAVTTVVNPKYEGK -> SLSVAQPGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP (in isoform 3); 778..798; GENPIYKSAVTTVVNPKYEGK -> PGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP (in isoform 4); 778..798; GENPIYKSAVTTVVNPKYEGK -> QENPIYKSPINNFKNPNYGRKAGL (in isoform 5)
3D Structural Models
Turn
26..31; 72..74; 77..79; 174..176; 193..195; 311..313
Helix
35..40; 61..63; 67..71; 101..103; 108..110; 153..155; 156..161; 162..164; 165..173; 200..204; 229..236; 251..260; 262..264; 287..291; 319..328; 339..341; 342..351; 367..379; 402..404; 409..413; 752..769; 770..772
Beta Strand
45..47; 52..54; 56..58; 64..66; 86..91; 97..100; 118..124; 129..136; 143..150; 180..187; 209..211; 218..227; 245..249; 269..280; 303..309; 331..337; 352..359; 362..364; 382..386; 393..400; 406..408; 414..417; 423..432; 437..439; 441..447; 454..461
3D Structure
Electron microscopy (9); NMR spectroscopy (1); X-ray crystallography (11)
Domain & Motif Annotations
Compositional Bias
81..91; Basic and acidic residues
Domain (CC)
The VWFA domain (or beta I domain) contains three cation-binding sites: the ligand-associated metal ion-binding site (LIMBS or SyMBS), the metal ion-dependent adhesion site (MIDAS), and the adjacent MIDAS site (ADMIDAS). This domain is also part of the ligand-binding site.
Domain (FT)
26..76; PSI; 140..378; VWFA; 466..501; I-EGF 1; 502..554; I-EGF 2; 555..591; I-EGF 3; 592..631; I-EGF 4
Region
75..107; Disordered; 207..213; CX3CL1-binding; 295..314; CX3CL1-binding; 383..465; Interaction with TMEM182; 762..767; Signal for sorting from recycling endosomes; interaction with ACAP1; 785..792; Interaction with ITGB1BP1
Protein Families
Integrin beta chain family
Sequence Similarities
Belongs to the integrin beta chain family.
Clinical Relevance
Disease Involvement
Cancer-related genesFDA approved drug targets
Related Diseases
Biomarker
Phase 1; Phase 1/2
Drug Targets
FDA approved drug targets
Drugs
Interaction Protein
ENSG00000091409ENSG00000115414ENSG00000115641ENSG00000127022ENSG00000130234ENSG00000135404ENSG00000137076ENSG00000161638ENSG00000164171ENSG00000177697ENSG00000196924
Interaction Count
11
Interaction Dataset
intact_biogridbiogrid_opencell