Protein detail
ITB1
Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)
Entry name ITB1 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 3 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Integrin beta-1 (Fibronectin receptor subunit beta) (Glycoprotein IIa) (GPIIA) (VLA-4 subunit beta) (CD antigen CD29)
Protein Class (7)
Cancer-related genesCD markersFDA approved drug targetsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Transporters
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- FDA approved drug targets:Biotech drugs
Transmembrane
729..751; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (5)
CD29FNRBGPIIAMDF2MSK12
Gene Description
Integrin subunit beta 1
Chromosome
10
Position
32887273-33005792
Supporting publications (n)
3
EVMP confidence score
0.50
Fluorescence & Localization3
Tissue SpecificbrainCell SpecificAstrocytesSingle-Nuclei Brain Specificastrocyte
Function & Pathway7
Protein Function (5)
- Transporters
- Predicted intracellular proteins
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- FDA approved drug targets:Biotech drugs
Cellular Component (41)
- GO:0001726 ruffle
- GO:0005737 cytoplasm
- GO:0005886 plasma membrane
- GO:0005925 focal adhesion
- GO:0008305 integrin complex
- GO:0009897 external side of plasma membrane
- GO:0009986 cell surface
- GO:0010008 endosome membrane
- GO:0014704 intercalated disc
- GO:0016020 membrane
Page 1 of 5
Molecular Function (19)
- GO:0000287 magnesium ion binding
- GO:0001618 virus receptor activity
- GO:0001968 fibronectin binding
- GO:0002020 protease binding
- GO:0003779 actin binding
- GO:0005178 integrin binding
- GO:0005509 calcium ion binding
- GO:0005515 protein binding
- GO:0015026 coreceptor activity
- GO:0019901 protein kinase binding
Page 1 of 2
Biological Process (3)
KEGG (29)
- hsa03271 Virion - Rotavirus
- KEGG:hsa04015 Rap1 signaling pathway
- KEGG:hsa04145 Phagosome
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04518 Integrin signaling
Page 1 of 3
Reactome (65)
- R-hsa-1280218 adaptive immune system
- R-hsa-210991 basigin interactions
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1500931 cell cell communication
- R-hsa-446353 cell extracellular matrix interactions
- R-hsa-446728 cell junction organization
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-447041 chl1 interactions
- R-hsa-1280215 cytokine signaling in immune system
Page 1 of 7
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence128
Enzyme-Mediated Modification (17)
17 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| ITGB1 | PRKCE | Q02156 | T | 789 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| ITGB1 | PRKCE | Q02156 | T | 788 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| ITGB1 | ABL2 | P42684 | Y | 783 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| ITGB1 | PRKCA | P17252 | S | 785 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| ITGB1 | TGFB1 | P01137 | T | 788 | phosphorylation | RLIMS-P_ProtMapperProtMapper | ProtMapper:19115199 |
| ITGB1 | PTP4A3 | O75365 | Y | 783 | phosphorylation | NCI-PID_ProtMapperProtMapper | |
| ITGB1 | SRC | P12931 | Y | 795 | phosphorylation | BEL-Large-Corpus_ProtMapperProtMapper | ProtMapper:11259684 |
Page 2 of 2Previous
Ligand-Receptor Signaling (71)
71 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
| intracellular | intracellular | LOCATE | No | No | No | Yes | No |
| intracellular | intracellular | ComPPI | No | No | No | Yes | No |
| intracellular | intracellular | GO_Intercell | No | No | No | Yes | No |
| intracellular | intracellular | UniProt_location | No | No | No | Yes | No |
| intracellular | intracellular | OmniPath | No | No | No | Yes | No |
| adhesion | adhesion | Adhesome | Yes | Yes | No | Yes | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | Yes | No |
| matrix_adhesion | matrix_adhesion | Cellinker | No | Yes | No | Yes | No |
Regulatory Interaction Network (28)
28 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| PTPRG | P23470 | ITB1 | P05556 | Yes | No | Yes | SIGNOR_ProtMapperSIGNORProtMapper | SIGNOR:25624455ProtMapper:25624455 |
| PCDA2 | Q9Y5H9 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:16697637 |
| PCDA8 | Q9Y5H6 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:16697637 |
| PCDA7 | Q9UN72 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:16697637 |
| PCDAB | Q9Y5I1 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:16697637 |
| PCDAD | Q9Y5I0 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:16697637 |
| URP2 | Q86UX7 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:18278053 |
| TP4A3 | O75365 | ITB1 | P05556 | Yes | Yes | Yes | NCI-PID_ProtMapperSIGNORProtMapperDEPODWang | DEPOD:16472776SIGNOR:23092334DEPOD:19930715 |
| PCDAA | Q9Y5I2 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:16697637 |
| PCDA6 | Q9UN73 | ITB1 | P05556 | Yes | Yes | No | SIGNOR | SIGNOR:16697637 |
Protein Complex Composition (11)
11 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| A1/b1 integrin | ITGA1ITGB1 | P05556P56199 | 1:1 | CellChatDBCellPhoneDBSIGNORICELLNETComplexPortalCellinker | CellPhoneDB:integrin_a1b1_complexSIGNOR:SIGNOR-C159intact:EBI-2554495 | 268578151229704217671519151477201536106419693543147552921698802421421911 |
| A10/b1 integrin | ITGA10ITGB1 | O75578P05556 | 1:1 | CellChatDBCellPhoneDBSIGNORICELLNETComplexPortalCORUMCompleatCellinker | CellPhoneDB:integrin_a10b1_complexintact:EBI-2568006CORUM:3057Compleat:HC127SIGNOR:SIGNOR-C167 | 268578151229704215147720196935431475529296853911698802421421911 |
| ICAP1-KRIT1 integrin activation complex | ITGB1BP1KRIT1 | O00522O14713 | 4:4 | ComplexPortalhu.MAP2PDB | PDB:4jifintact:EBI-12738771PDB:4dx8PDB:4JIF | 1475529223317506 |
| ITGA1-ITGB1-COL6A3 complex | COL6A3ITGA1ITGB1 | P05556P12111P56199 | 1:1:1 | CompleatCORUM | CORUM:2434Compleat:HC2367 | 8387021 |
| ITGA1-ITGB1-PTPN2 complex | ITGA1ITGB1PTPN2 | P05556P17706P56199 | 1:1:1 | CompleatCORUM | CORUM:2435Compleat:HC3355 | 15592458 |
| ITGB1-RACK1 complex | ITGB1RACK1 | P05556P63244 | 0:0 | CORUM | CORUM:7012 | 9442085 |
| KRIT1-CCM2-ICAP1 complex | CCM2ITGB1BP1KRIT1 | O00522O14713Q9BSQ5 | 0:0:0 | CORUMhu.MAP2 | CORUM:6223 | 16037064 |
| ITGB1ITGB1BP1 | O14713P05556 | 32:30 | PDB | PDB:4dx9 | ||
| CCN2FBLN1FN1HSPG2ITGB1 | P02751P05556P23142P29279P98160 | 1:1:1:1:1 | CompleatCFinder | Compleat:HC4110 | ||
| ITGB1 | P05556 | 2 | PDB | PDB:3t9k |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometry | 1 | 38014595 |
Sequence, Structure & Domains15
Sequences
Length
798
Mass
88,415
Sequence
MNLQPIFWIGLISSVCCVFAQTDENRCLKANAKSCGECIQAGPNCGWCTNSTFLQEGMPTSARCDDLEALKKKGCPPDDIENPRGSKDIKKNKNVTNRSKGTAEKLKPEDITQIQPQQLVLRLRSGEPQTFTLKFKRAEDYPIDLYYLMDLSYSMKDDLENVKSLGTDLMNEMRRITSDFRIGFGSFVEKTVMPYISTTPAKLRNPCTSEQNCTSPFSYKNVLSLTNKGEVFNELVGKQRISGNLDSPEGGFDAIMQVAVCGSLIGWRNVTRLLVFSTDAGFHFAGDGKLGGIVLPNDGQCHLENNMYTMSHYYDYPSIAHLVQKLSENNIQTIFAVTEEFQPVYKELKNLIPKSAVGTLSANSSNVIQLIIDAYNSLSSEVILENGKLSEGVTISYKSYCKNGVNGTGENGRKCSNISIGDEVQFEISITSNKCPKKDSDSFKIRPLGFTEEVEVILQYICECECQSEGIPESPKCHEGNGTFECGACRCNEGRVGRHCECSTDEVNSEDMDAYCRKENSSEICSNNGECVCGQCVCRKRDNTNEIYSGKFCECDNFNCDRSNGLICGGNGVCKCRVCECNPNYTGSACDCSLDTSTCEASNGQICNGRGICECGVCKCTDPKFQGQTCEMCQTCLGVCAEHKECVQCRAFNKGEKKDTCTQECSYFNITKVESRDKLPQPVQPDPVSHCKEKDVDDCWFYFTYSVNGNNEVMVHVVENPECPTGPDIIPIVAGVVAGIVLIGLALLLIWKLLMIIHDRREFAKFEKEKMNAKWDTGENPIYKSAVTTVVNPKYEGK
Alternative Products
Event=Alternative splicing; Named isoforms=5; Name=1; Synonyms=Beta-1A; IsoId=P05556-1; Sequence=Displayed; Name=2; Synonyms=Beta-1B; IsoId=P05556-2; Sequence=VSP_002741; Name=3; Synonyms=Beta-1C; IsoId=P05556-3; Sequence=VSP_002742; Name=4; Synonyms=Beta-1C-2; IsoId=P05556-4; Sequence=VSP_002743; Name=5; Synonyms=Beta-1D; IsoId=P05556-5; Sequence=VSP_002744
Alternative Sequence
778..798; GENPIYKSAVTTVVNPKYEGK -> VSYKTSKKQSGL (in isoform 2); 778..798; GENPIYKSAVTTVVNPKYEGK -> SLSVAQPGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP (in isoform 3); 778..798; GENPIYKSAVTTVVNPKYEGK -> PGVQWCDISSLQPLTSRFQQFSCLSLPSTWDYRVKILFIRVP (in isoform 4); 778..798; GENPIYKSAVTTVVNPKYEGK -> QENPIYKSPINNFKNPNYGRKAGL (in isoform 5)
3D Structural Models
Turn
26..31; 72..74; 77..79; 174..176; 193..195; 311..313
Helix
35..40; 61..63; 67..71; 101..103; 108..110; 153..155; 156..161; 162..164; 165..173; 200..204; 229..236; 251..260; 262..264; 287..291; 319..328; 339..341; 342..351; 367..379; 402..404; 409..413; 752..769; 770..772
Beta Strand
45..47; 52..54; 56..58; 64..66; 86..91; 97..100; 118..124; 129..136; 143..150; 180..187; 209..211; 218..227; 245..249; 269..280; 303..309; 331..337; 352..359; 362..364; 382..386; 393..400; 406..408; 414..417; 423..432; 437..439; 441..447; 454..461
3D Structure
Electron microscopy (9); NMR spectroscopy (1); X-ray crystallography (11)
Domain & Motif Annotations
Compositional Bias
81..91; Basic and acidic residues
Domain (CC)
The VWFA domain (or beta I domain) contains three cation-binding sites: the ligand-associated metal ion-binding site (LIMBS or SyMBS), the metal ion-dependent adhesion site (MIDAS), and the adjacent MIDAS site (ADMIDAS). This domain is also part of the ligand-binding site.
Domain (FT)
26..76; PSI; 140..378; VWFA; 466..501; I-EGF 1; 502..554; I-EGF 2; 555..591; I-EGF 3; 592..631; I-EGF 4
Region
75..107; Disordered; 207..213; CX3CL1-binding; 295..314; CX3CL1-binding; 383..465; Interaction with TMEM182; 762..767; Signal for sorting from recycling endosomes; interaction with ACAP1; 785..792; Interaction with ITGB1BP1
Protein Families
Integrin beta chain family
Sequence Similarities
Belongs to the integrin beta chain family.
Clinical Relevance9
Disease Involvement (2)
Cancer-related genesFDA approved drug targets
Related Diseases (3)
Biomarker
Phase 1; Phase 1/2
Drug Targets
FDA approved drug targets
Drugs (13)
Interaction Protein (11)
ENSG00000091409ENSG00000115414ENSG00000115641ENSG00000127022ENSG00000130234ENSG00000135404ENSG00000137076ENSG00000161638ENSG00000164171ENSG00000177697ENSG00000196924
Interaction Count
11
Interaction Dataset (2)
intact_biogridbiogrid_opencell
Supporting Publications3
| PMID | Title | Abstract |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 38073039 | Matrix Metalloproteinase-7 in Urinary Extracellular Vesicles Identifies Rapid Disease Progression in Autosomal Dominant Polycystic Kidney Disease. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |