Protein detail
CD5
T-cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu-1) (CD antigen CD5)
Entry name CD5 | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 4 | Transmembrane count 1 | Protein classification CD markersPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
T-cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu-1) (CD antigen CD5)
Protein Class (3)
CD markersPredicted intracellular proteinsPredicted membrane proteins
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Transmembrane
373..402; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
LEU1T1
Gene Description
CD5 molecule
Chromosome
11
Position
61102489-61127852
Supporting publications (n)
4
EVMP confidence score
0.53
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway
Protein Function (2)
- CD markers
- Predicted intracellular proteins
Cellular Component (2)
Molecular Function (2)
Biological Process (3)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence85
Enzyme-Mediated Modification (22)
22 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD5 | CSNK2A1 | P68400 | S | 482 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:9834084KEA:9834084SIGNOR:9834084ProtMapper:9834084HPRD:9834084 |
| CD5 | CSNK2A1 | P68400 | S | 483 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:9834084KEA:9834084SIGNOR:9834084ProtMapper:9834084HPRD:9834084 |
| CD5 | CSNK2A1 | P68400 | S | 485 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | phosphoELM:9834084KEA:9834084SIGNOR:9834084ProtMapper:9834084HPRD:9834084 |
| CD5 | LCK | P06239 | Y | 453 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:11298344phosphoELM:11298344HPRD:15144186KEA:15659558KEA:11298344KEA:15144186SIGNOR:11298344HPRD:11298344KEA:12522270 |
| CD5 | LCK | P06239 | Y | 487 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:11298344phosphoELM:11298344SIGNOR:11298344KEA:11298344HPRD:11298344 |
| CD5 | PRKCA | P17252 | T | 434 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317phosphoELM:11123317 |
| CD5 | PRKCA | P17252 | T | 436 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEAphosphoELMSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317phosphoELM:11123317 |
| CD5 | PRKCG | P05129 | T | 436 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317 |
| CD5 | PRKCG | P05129 | T | 434 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317 |
| CD5 | PRKCB | P05771 | T | 434 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperKEASIGNOR_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317 |
Page 1 of 3Next
Ligand-Receptor Signaling (42)
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_sosui | transmembrane_predicted | Almen2009 | Yes | ||||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | Yes |
Page 5 of 5Previous
Regulatory Interaction Network (6)
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LCK | P06239 | CD5 | P06127 | Yes | Yes | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEADIPPhosphoNetworksHPRDWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperHPRD-phos | ProtMapper:11298344ProtMapper:15144186phosphoELM:11298344DIP:7513045HPRD:15144186HPRD:7513045KEA:11298344KEA:15144186KEA:15659558SIGNOR:11298344HPRD:11298344HPRD-phos:11298344HPRD-phos:15144186KEA:12522270 | |
| CSK21 | P68400 | CD5 | P06127 | Yes | Yes | HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteHPRD-phos | PhosphoSite:9834084SIGNOR:9834084KEA:9834084phosphoELM:9834084HPRD:9834084ProtMapper:9834084HPRD-phos:9834084 | |
| KPCB | P05771 | CD5 | P06127 | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317HPRD:11123317 | ||
| KPCG | P05129 | CD5 | P06127 | Yes | Yes | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317HPRD:11123317 | |
| FYN | P06241 | CD5 | P06127 | Yes | Yes | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | PhosphoSite:26363459ProtMapper:11298344ProtMapper:15144186HPRD:15144186KEA:15659558KEA:11298344KEA:15144186SIGNOR:11298344PhosphoSite:11751967HPRD:11298344PhosphoSite:11298344HPRD-phos:11298344HPRD-phos:15144186KEA:12522270 | |
| KPCA | P17252 | CD5 | P06127 | Yes | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:11123317KEA:11123317HPRD:11123317SIGNOR:11123317phosphoELM:11123317 |
Protein Complex Composition (14)
14 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster458 | MSANTD1SCDSCD5 | O00767Q6ZTZ1Q86SK9 | 1:1:1 | Compleat | Compleat:HC241 | 22036573 |
| CCT4CCT8HGH1MLST8PDCD5PDCLPDCL3TXNDC9 | O14530O14737P50990P50991Q13371Q9BTY7Q9BVC4Q9H2J4 | 0:0:0:0:0:0:0:0 | hu.MAP | |||
| HGH1PDCD5PDCL3TXNDC9 | O14530O14737Q9BTY7Q9H2J4 | 0:0:0:0 | hu.MAP | |||
| HGH1PDCD5PDCL3SEC31BTXNDC9 | O14530O14737Q9BTY7Q9H2J4Q9NQW1 | 0:0:0:0:0 | hu.MAP | |||
| IMPA1MTIF2PDCD5PLBD2PPA2 | O14737P29218P46199Q8NHP8Q9H2U2 | 0:0:0:0:0 | hu.MAP2 | |||
| HGH1MLST8PDCD5 | O14737Q9BTY7Q9BVC4 | 0:0:0 | hu.MAP | |||
| C2CD5CABLES1CABLES2FIBPTMEM94 | O43427Q12767Q86YS7Q8TDN4Q9BTV7 | 0:0:0:0:0 | hu.MAPhu.MAP2 | |||
| C2CD5CABLES1CABLES2FIBP | O43427Q86YS7Q8TDN4Q9BTV7 | 0:0:0:0 | hu.MAP2 | |||
| C2CD5ESRRAIPO13PWP2RRP9WDR36 | O43818O94829P11474Q15269Q86YS7Q8NI36 | 0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_504 | ||
| CD5LIGHMJCHAIN | O43866P01591P01871 | 1:1:10 | PDB | PDB:8r84PDB:8wysPDB:8wyrPDB:8r83 |
Page 1 of 2Next
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 32230970 |
Sequence, Structure & Domains
Sequences
Length
495
Mass
54,578
Sequence
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
3D Structural Models
Turn
101..103
Helix
75..77; 78..83; 310..318; 347..349
Beta Strand
35..37; 39..42; 45..52; 55..58; 86..88; 90..94; 104..110; 117..119; 122..124; 126..132; 275..280; 286..295; 298..301; 323..331; 339..341; 344..346; 354..356; 362..367
3D Structure
NMR spectroscopy (2); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
142..155; Pro residues; 475..484; Polar residues
Domain (FT)
35..133; SRCR 1; 159..268; SRCR 2; 276..368; SRCR 3
Region
136..155; Disordered; 436..460; Disordered; 473..495; Disordered
Clinical Relevance
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 32230970 | Radiation Exposure of Peripheral Mononuclear Blood Cells Alters the Composition and Function of Secreted Extracellular Vesicles. | No related sentences available |
| 38113368 | In-Depth Proteome Profiling of Small Extracellular Vesicles Isolated from Cancer Cell Lines and Patient Serum. | No related sentences available |
| 40730843 | Single urinary extracellular vesicle proteomics identifies complement receptor CD35 as a biomarker for sepsis-associated acute kidney injury. | No related sentences available |
| 41068253 | Identification of plasma extracellular vesicle protein biomarkers in diabetic retinopathy progression. | No related sentences available |