Protein detail
CD5
T-cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu-1) (CD antigen CD5)
Protein symbol CD5 | UniProt ID | EVMP score 0.25 |
Frequency 4 | Transmembrane count 1 | Protein classification CD markersPredicted intracellular proteinsPredicted membrane proteins |
Basic Information
Protein Names
T-cell surface glycoprotein CD5 (Lymphocyte antigen T1/Leu-1) (CD antigen CD5)
Protein Class
CD markersPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- CD markers
- Predicted intracellular proteins
Transmembrane
373..402; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
LEU1T1
Gene Description
CD5 molecule
Chromosome
11
Position
61102489-61127852
Frequency
4
EVMP Score
0.25
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificcDCSingle-Nuclei Brain Specificcentral nervous system macrophage
Function & Pathway
Protein Function
- CD markers
- Predicted intracellular proteins
Cellular Component
Molecular Function
Biological Process
Mediation Categories
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
22 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD5 | PRKG1 | Q13976 | S | 439 | phosphorylation | KEA | KEA:17570479 |
| CD5 | PRKG1 | Q13976 | S | 460 | phosphorylation | KEA | KEA:17570479 |
Page 3 of 3Previous
Ligand-Receptor Signaling
42 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| scavenger_receptor_cysteine_rich | receptor | OmniPath | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
| extracellular | extracellular | DGIdb | No | No | No | Yes | No |
| extracellular | extracellular | OmniPath | No | No | No | Yes | No |
Page 1 of 5Next
Regulatory Interaction Network
6 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| LCK | P06239 | CD5 | P06127 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperPhosphoSite_KEAphosphoELM_KEADIPPhosphoNetworksHPRDWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperHPRD-phos | ProtMapper:11298344ProtMapper:15144186phosphoELM:11298344DIP:7513045HPRD:15144186HPRD:7513045KEA:11298344KEA:15144186KEA:15659558SIGNOR:11298344HPRD:11298344HPRD-phos:11298344HPRD-phos:15144186KEA:12522270 |
| CSK21 | P68400 | CD5 | P06127 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSiteHPRD-phos | PhosphoSite:9834084SIGNOR:9834084KEA:9834084phosphoELM:9834084HPRD:9834084ProtMapper:9834084HPRD-phos:9834084 |
| KPCB | P05771 | CD5 | P06127 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317HPRD:11123317 |
| KPCG | P05129 | CD5 | P06127 | Yes | Yes | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefPhosphoPointSIGNORProtMapperiPTMnetHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:11123317KEA:11123317ProtMapper:11123317HPRD:11123317 |
| FYN | P06241 | CD5 | P06127 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | PhosphoSite:26363459ProtMapper:11298344ProtMapper:15144186HPRD:15144186KEA:15659558KEA:11298344KEA:15144186SIGNOR:11298344PhosphoSite:11751967HPRD:11298344PhosphoSite:11298344HPRD-phos:11298344HPRD-phos:15144186KEA:12522270 |
| KPCA | P17252 | CD5 | P06127 | Yes | Yes | No | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAphosphoELM_KEAHPRD_KEAphosphoELMSIGNOR_ProtMapperPhosphoSite_ProtMapper | ProtMapper:11123317KEA:11123317HPRD:11123317SIGNOR:11123317phosphoELM:11123317 |
Protein Complex Composition
14 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster458 | MSANTD1SCDSCD5 | O00767Q6ZTZ1Q86SK9 | 1:1:1 | Compleat | Compleat:HC241 | 22036573 |
| CCT4CCT8HGH1MLST8PDCD5PDCLPDCL3TXNDC9 | O14530O14737P50990P50991Q13371Q9BTY7Q9BVC4Q9H2J4 | 0:0:0:0:0:0:0:0 | hu.MAP | |||
| HGH1PDCD5PDCL3TXNDC9 | O14530O14737Q9BTY7Q9H2J4 | 0:0:0:0 | hu.MAP | |||
| HGH1PDCD5PDCL3SEC31BTXNDC9 | O14530O14737Q9BTY7Q9H2J4Q9NQW1 | 0:0:0:0:0 | hu.MAP | |||
| IMPA1MTIF2PDCD5PLBD2PPA2 | O14737P29218P46199Q8NHP8Q9H2U2 | 0:0:0:0:0 | hu.MAP2 | |||
| HGH1MLST8PDCD5 | O14737Q9BTY7Q9BVC4 | 0:0:0 | hu.MAP | |||
| C2CD5CABLES1CABLES2FIBPTMEM94 | O43427Q12767Q86YS7Q8TDN4Q9BTV7 | 0:0:0:0:0 | hu.MAPhu.MAP2 | |||
| C2CD5CABLES1CABLES2FIBP | O43427Q86YS7Q8TDN4Q9BTV7 | 0:0:0:0 | hu.MAP2 | |||
| C2CD5ESRRAIPO13PWP2RRP9WDR36 | O43818O94829P11474Q15269Q86YS7Q8NI36 | 0:0:0:0:0:0 | Havugimana2012 | Havugimana2012:C_504 | ||
| CD5LIGHMJCHAIN | O43866P01591P01871 | 1:1:10 | PDB | PDB:8r84PDB:8wysPDB:8wyrPDB:8r83 |
Page 1 of 2Next
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 32230970 |
Sequence, Structure & Domains
Sequences
Length
495
Mass
54,578
Sequence
MPMGSLQPLATLYLLGMLVASCLGRLSWYDPDFQARLTRSNSKCQGQLEVYLKDGWHMVCSQSWGRSSKQWEDPSQASKVCQRLNCGVPLSLGPFLVTYTPQSSIICYGQLGSFSNCSHSRNDMCHSLGLTCLEPQKTTPPTTRPPPTTTPEPTAPPRLQLVAQSGGQHCAGVVEFYSGSLGGTISYEAQDKTQDLENFLCNNLQCGSFLKHLPETEAGRAQDPGEPREHQPLPIQWKIQNSSCTSLEHCFRKIKPQKSGRVLALLCSGFQPKVQSRLVGGSSICEGTVEVRQGAQWAALCDSSSARSSLRWEEVCREQQCGSVNSYRVLDAGDPTSRGLFCPHQKLSQCHELWERNSYCKKVFVTCQDPNPAGLAAGTVASIILALVLLVVLLVVCGPLAYKKLVKKFRQKKQRQWIGPTGMNQNMSFHRNHTATVRSHAENPTASHVDNEYSQPPRNSHLSAYPALEGALHRSSMQPDNSSDSDYDLHGAQRL
3D Structural Models
Turn
101..103
Helix
75..77; 78..83; 310..318; 347..349
Beta Strand
35..37; 39..42; 45..52; 55..58; 86..88; 90..94; 104..110; 117..119; 122..124; 126..132; 275..280; 286..295; 298..301; 323..331; 339..341; 344..346; 354..356; 362..367
3D Structure
NMR spectroscopy (2); X-ray crystallography (2)
Domain & Motif Annotations
Compositional Bias
142..155; Pro residues; 475..484; Polar residues
Domain (FT)
35..133; SRCR 1; 159..268; SRCR 2; 276..368; SRCR 3
Region
136..155; Disordered; 436..460; Disordered; 473..495; Disordered