Protein detail
FYN
Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)
Entry name FYN | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 1 | Transmembrane count | Protein classification EnzymesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)
Protein Class (3)
EnzymesPlasma proteinsPredicted intracellular proteins
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases:Tyr protein kinases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
MGC45350SLKSYN
Gene Description
FYN proto-oncogene, Src family tyrosine kinase
Chromosome
6
Position
111660332-111873452
Supporting publications (n)
1
EVMP confidence score
0.38
Fluorescence & Localization6
Tissue Specificbone marrowCell SpecificExtravillous trophoblastsSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificgdT-cellBlood Lineage SpecificNK-cells
Function & Pathway7
Protein Function (4)
- ENZYME proteins:Transferases
- Enzymes
- Kinases:Tyr protein kinases
- Predicted intracellular proteins
Cellular Component (15)
- GO:0005634 nucleus
- GO:0005739 mitochondrion
- GO:0005768 endosome
- GO:0005829 cytosol
- GO:0005884 actin filament
- GO:0005886 plasma membrane
- GO:0014069 postsynaptic density
- GO:0030425 dendrite
- GO:0043204 perikaryon
- GO:0044297 cell body
Page 1 of 2
Molecular Function (20)
- GO:0001664 G protein-coupled receptor binding
- GO:0004713 protein tyrosine kinase activity
- GO:0004715 non-membrane spanning protein tyrosine kinase activity
- GO:0005102 signaling receptor binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0016004 phospholipase activator activity
- GO:0019899 enzyme binding
- GO:0031802 type 5 metabotropic glutamate receptor binding
- GO:0042802 identical protein binding
Page 1 of 2
Biological Process (3)
KEGG (15)
- hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04520 Adherens junction
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04660 T cell receptor signaling pathway
Page 1 of 2
Reactome (81)
- R-hsa-9032500 activated ntrk2 signals through fyn
- R-hsa-1280218 adaptive immune system
- R-hsa-418990 adherens junctions interactions
- R-hsa-983695 antigen activates b cell receptor bcr leading to generation of second messengers
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-5621575 cd209 dc sign signaling
- R-hsa-389357 cd28 dependent pi3k akt signaling
- R-hsa-389359 cd28 dependent vav1 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
Page 1 of 9
Mediation Categories (6)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence178
Enzyme-Mediated Modification (45)
45 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FYN | PTPRF | P10586 | Y | 531 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:12496362 |
| FYN | PTPRF | P10586 | Y | 420 | phosphorylation | SIGNOR_ProtMapperProtMapper | ProtMapper:12496362 |
| FYN | PTPN5 | P54829 | Y | 420 | dephosphorylation | SIGNORDEPOD | DEPOD:11983687SIGNOR:11983687 |
| FYN | PTPN5 | P54829 | Y | 420 | phosphorylation | SIGNOR_ProtMapperREACH_ProtMapperProtMapper | ProtMapper:22840751ProtMapper:11983687 |
| FYN | PTPRC | P08575 | Y | 531 | dephosphorylation | HPRDDEPOD | HPRD:8980254DEPOD:1533589HPRD:9535845 |
| FYN | PTPRC | P08575 | Y | 528 | dephosphorylation | HPRD | HPRD:8980254HPRD:9535845 |
| FYN | PTPRC | P08575 | Y | 476 | dephosphorylation | HPRD | HPRD:8980254HPRD:9535845 |
| FYN | PTPRC | P08575 | Y | 531 | phosphorylation | NCI-PID_ProtMapperSIGNOR_ProtMapperKEAProtMapper | ProtMapper:1464315ProtMapper:11909961KEA:1985196 |
| FYN | PTPRC | P08575 | Y | 420 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:1464315 |
| FYN | PTPRA | P18433 | Y | 531 | dephosphorylation | HPRDDEPOD | HPRD:15588985DEPOD:9535845HPRD:8980254HPRD:9535845 |
Ligand-Receptor Signaling (16)
16 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network (113)
113 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| FYN | P06241 | MK14 | Q16539 | Yes | Yes | No | WangphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperKinexus_KEAKEASIGNOR_ProtMapperPhosphoSite_ProtMapper | SIGNOR:15735648ProtMapper:15735648KEA:15735648 |
| FYN | P06241 | TRIO | O75962 | Yes | Yes | No | SIGNOR | SIGNOR:23230270 |
| FYN | P06241 | 6PGD | P52209 | Yes | Yes | No | iPTMnetSIGNORProtMapperSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | ProtMapper:30824700SIGNOR:30824700PhosphoSite:30824700 |
| FYN | P06241 | NOX4 | Q9NPH5 | Yes | No | Yes | PhosphoSite_norefSIGNORProtMapperREACH_ProtMapperPhosphoSite_ProtMapper | SIGNOR:27525436ProtMapper:27833552 |
| FYN | P06241 | RHG33 | O14559 | Yes | No | Yes | PhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetSIGNORProtMapperREACH_ProtMapperHPRDPhosphoSiteKEAHPRD_KEASIGNOR_ProtMapperLit-BM-17HPRD-phosPhosphoSite_ProtMapper | Lit-BM-17:16777849HPRD:16777849SIGNOR:16777849PhosphoSite:16777849HPRD-phos:16777849ProtMapper:16777849KEA:16777849 |
| PGFRB | P09619 | FYN | P06241 | Yes | Yes | No | HPRD_MIMPSIGNORProtMapperHINTPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksHPRDKinexus_KEAIntActWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPPhosphoSite_norefPhosphoPointiPTMnetELMKEAHPRD_KEAphosphoELMSIGNOR_ProtMapperSPIKE_LC | IntAct:7687537HINT:1661130ProtMapper:9425276IntAct:1661130HINT:7685273ELM:7685273phosphoELM:9425276SIGNOR:9425276HPRD:1696179ELM:7730365ELM:7687537HINT:7520528HINT:7687537KEA:9425276IntAct:7685273HPRD:9425276ELM:12706723SPIKE_LC:16713569iPTMnet:9425276 |
| FYN | P06241 | CLM7 | A8K4G0 | Yes | Yes | No | PhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperdbPTMInnateDBSIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | dbPTM:17928527PhosphoSite:17928527PhosphoSite:16920917SIGNOR:16920917InnateDB:16920917dbPTM:16920917ProtMapper:16920917 |
| CSK | P41240 | FYN | P06241 | Yes | Yes | No | HPRD_MIMPProtMapperRLIMS-P_ProtMapperdbPTMPhosphoSite_KEAphosphoELM_KEAPhosphoNetworksNCI-PID_ProtMapperHPRDKinexus_KEAWangPhosphoSite_ProtMapperphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetPhosphoPointKEAHPRD_KEAphosphoELMREACH_ProtMapperPhosphoSiteAdhesomeSPIKE_LCHPRD-phos | dbPTM:18691976PhosphoSite:15713745ProtMapper:16537894dbPTM:1533589dbPTM:1699196dbPTM:19369195ProtMapper:14967142KEA:1985196ProtMapper:1985196phosphoELM:1985196HPRD-phos:1985196ProtMapper:18691976ProtMapper:9647655PhosphoSite:1533589HPRD:8262983Adhesome:1985196ProtMapper:25720756ProtMapper:11489946PhosphoSite:1699196Adhesome:7524477HPRD:1985196HPRD-phos:18691976ProtMapper:10366594SPIKE_LC:16713569Adhesome:8262983 |
| FYN | P06241 | FCG2B | P31994 | Yes | Yes | No | DOMINOWangphosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetProtMapperSPIKE_LCPhosphoSitePhosphoSite_ProtMapper | SPIKE_LC:17474147PhosphoSite:8756631DOMINO:17474147PhosphoSite:10704309 |
| FYN | P06241 | CD3E | P07766 | Yes | No | No | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPPhosphoSite_norefiPTMnetProtMapperWangPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:15570572PhosphoSite:17617578PhosphoSite:20005895PhosphoSite:32317279PhosphoSite:16094384PhosphoSite:18555270PhosphoSite:15659558 |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ABL1DLGAP4FYNPIK3R1 | P00519P06241P27986Q9Y2H0 | 1:1:1:1 | CompleatCFinder | Compleat:HC4289 | ||
| FYN | P06241 | 2 | PDB | PDB:1g83PDB:3h0iPDB:4u17PDB:4znxPDB:7a2jPDB:2mrkPDB:7a2mPDB:7a2lPDB:3ua6PDB:1shfPDB:7a2nPDB:7a2k | ||
| FYNPIK3R1 | P06241P27986 | 1:1 | PDB | PDB:1a0nPDB:1azg |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryR Sequencing | 1 | 30865381 |
Sequence, Structure & Domains13
Sequences
Length
537
Mass
60,762
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=B; IsoId=P06241-1; Sequence=Displayed; Name=2; Synonyms=T; IsoId=P06241-2; Sequence=VSP_024110; Name=3; IsoId=P06241-3; Sequence=VSP_024108
Alternative Sequence
233..287; Missing (in isoform 3); 234..287; RAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWM -> KADGLCFNLTVIASSCTPQTSGLAKDAWEVARRSLCLEKKLGQGCFAEVWL (in isoform 2)
3D Structural Models
Turn
125..127; 165..167; 194..196; 209..211; 291..293; 303..305; 358..360; 400..402; 430..432
Helix
135..137; 141..143; 144..146; 156..163; 224..233; 268..270; 308..318; 350..354; 364..383; 393..395; 435..438; 445..460; 472..481; 496..502; 507..509; 513..521
Beta Strand
87..91; 97..100; 108..113; 115..124; 130..134; 138..140; 147..150; 172..177; 179..181; 185..193; 197..207; 213..216; 219..223; 238..240; 263..265; 271..278; 285..290; 294..299; 329..333; 335..337; 339..343; 355..357; 396..399; 403..406; 416..418
3D Structure
NMR spectroscopy (11); X-ray crystallography (40)
Domain & Motif Annotations
Domain (FT)
82..143; SH3; 149..246; SH2; 271..524; Protein kinase
Region
14..35; Disordered
Protein Families (3)
- Protein kinase superfamily
- Tyr protein kinase family
- SRC subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
Clinical Relevance9
Disease Involvement
Proto-oncogene
Related Diseases (3)
Biomarker
Phase 2; Approved; Phase 1
Drug Targets
Literature-reported target
Drugs (36)
CYC-116AST-4871-AZAKENPAULLONEVANDETANIBZM447439TG100-801CHEMBL:CHEMBL379975DASATINIB ANHYDROUSXL-228PAZOPANIBHM50316BARASERTIBCP-547632NVP-TAE684PD-0166285ENMD-981693ILORASERTIBALDESLEUKINDOVITINIBPP2ADAVOSERTIBKENPAULLONEENTRECTINIBRG-1530JNJ-26483327HESPERADINTAMATINIBENMD-2076PF-562271TOZASERTIBCHEMBL:CHEMBL546797CEDIRANIBCOMPOUND 13 [PMID: 17502136]CENISERTIBRECOMBINANT VASCULAR ENDOTHELIAL GROWTH FACTORBINDARIT
Interaction Protein (21)
ENSG00000005020ENSG00000015285ENSG00000050820ENSG00000065675ENSG00000076641ENSG00000080824ENSG00000082074ENSG00000096384ENSG00000100842ENSG00000105401ENSG00000110395ENSG00000117560ENSG00000120899ENSG00000121774ENSG00000134909ENSG00000142949ENSG00000143537ENSG00000145335ENSG00000169398ENSG00000186868ENSG00000197122
Interaction Count
21
Interaction Dataset
intact_biogrid
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 34656547 | Plasma exosomal proteomic studies of corneal epithelial injury in diabetic and non-diabetic group. | TEM indicated that the exosomes had a double-concave disc-like appearance, with a size of about 100 nm, and Western blot expressed as CD63 and TSG101. |