Protein detail
FYN
Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)
Entry name FYN | UniProt ID | EVMP score 0.38 |
Frequency 1 | Transmembrane count | Protein classification EnzymesPlasma proteinsPredicted intracellular proteins |
EVMP score: annotation confidence score.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information
Protein Names
Tyrosine-protein kinase Fyn (EC 2.7.10.2) (Proto-oncogene Syn) (Proto-oncogene c-Fyn) (Src-like kinase) (SLK) (p59-Fyn)
Protein Class
EnzymesPlasma proteinsPredicted intracellular proteins
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Kinases:Tyr protein kinases
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
MGC45350SLKSYN
Gene Description
FYN proto-oncogene, Src family tyrosine kinase
Chromosome
6
Position
111660332-111873452
Frequency
1
EVMP Score
0.38
Fluorescence & Localization
Tissue Specificbone marrowCell SpecificExtravillous trophoblastsSingle-Nuclei Brain SpecificleukocyteBlood Cell SpecificgdT-cellBlood Lineage SpecificNK-cells
Function & Pathway
Protein Function
- ENZYME proteins:Transferases
- Enzymes
- Kinases:Tyr protein kinases
- Predicted intracellular proteins
Cellular Component
- GO:0005634 nucleus
- GO:0005739 mitochondrion
- GO:0005768 endosome
- GO:0005829 cytosol
- GO:0005884 actin filament
- GO:0005886 plasma membrane
- GO:0014069 postsynaptic density
- GO:0030425 dendrite
- GO:0043204 perikaryon
- GO:0044297 cell body
- GO:0045121 membrane raft
- GO:0048471 perinuclear region of cytoplasm
- GO:0097038 perinuclear endoplasmic reticulum
- GO:0097386 glial cell projection
- GO:0098685 Schaffer collateral - CA1 synapse
Molecular Function
- GO:0001664 G protein-coupled receptor binding
- GO:0004713 protein tyrosine kinase activity
- GO:0004715 non-membrane spanning protein tyrosine kinase activity
- GO:0005102 signaling receptor binding
- GO:0005515 protein binding
- GO:0005524 ATP binding
- GO:0016004 phospholipase activator activity
- GO:0019899 enzyme binding
- GO:0031802 type 5 metabotropic glutamate receptor binding
- GO:0042802 identical protein binding
- GO:0043014 alpha-tubulin binding
- GO:0043274 phospholipase binding
- GO:0044325 transmembrane transporter binding
- GO:0046872 metal ion binding
- GO:0046875 ephrin receptor binding
- GO:0048156 tau protein binding
- GO:0050321 tau-protein kinase activity
- GO:0070851 growth factor receptor binding
- GO:0097110 scaffold protein binding
- GO:0097718 disordered domain specific binding
Biological Process
KEGG
- hsa04071 Sphingolipid signaling pathway
- KEGG:hsa04072 Phospholipase D signaling pathway
- KEGG:hsa04360 Axon guidance
- KEGG:hsa04380 Osteoclast differentiation
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04520 Adherens junction
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04650 Natural killer cell mediated cytotoxicity
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04664 Fc epsilon RI signaling pathway
- KEGG:hsa04725 Cholinergic synapse
- KEGG:hsa05020 Prion disease
- KEGG:hsa05130 Pathogenic Escherichia coli infection
- KEGG:hsa05416 Viral myocarditis
Reactome
- R-hsa-9032500 activated ntrk2 signals through fyn
- R-hsa-1280218 adaptive immune system
- R-hsa-418990 adherens junctions interactions
- R-hsa-983695 antigen activates b cell receptor bcr leading to generation of second messengers
- R-hsa-9662851 anti inflammatory response favouring leishmania parasite infection
- R-hsa-5621575 cd209 dc sign signaling
- R-hsa-389357 cd28 dependent pi3k akt signaling
- R-hsa-389359 cd28 dependent vav1 pathway
- R-hsa-9855142 cellular responses to mechanical stimuli
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-1500931 cell cell communication
- R-hsa-446728 cell junction organization
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-389513 co inhibition by ctla4
- R-hsa-389356 co stimulation by cd28
- R-hsa-399956 crmps in sema3a signaling
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-5621481 c type lectin receptors clrs
- R-hsa-2172127 dap12 interactions
- R-hsa-2424491 dap12 signaling
- R-hsa-418885 dcc mediated attractive signaling
- R-hsa-5621480 dectin 2 family
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-3928663 epha mediated growth cone collapse
- R-hsa-3928662 ephb mediated forward signaling
- R-hsa-3928664 ephrin signaling
- R-hsa-3928665 eph ephrin mediated repulsion of cells
- R-hsa-2682334 eph ephrin signaling
- R-hsa-2029480 fcgamma receptor fcgr dependent phagocytosis
- R-hsa-9664323 fcgr3a mediated il10 synthesis
- R-hsa-2029481 fcgr activation
- R-hsa-2454202 fc epsilon receptor fceri signaling
- R-hsa-9607240 flt3 signaling
- R-hsa-9706374 flt3 signaling through src family kinases
- R-hsa-114604 gpvi mediated activation cascade
- R-hsa-109582 hemostasis
- R-hsa-9856530 high laminar flow shear stress activates signaling by piezo1 and pecam1 cdh5 kdr in endothelial cells
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-512988 interleukin 3 interleukin 5 and gm csf signaling
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-9658195 leishmania infection
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-375165 ncam signaling for neurite out growth
- R-hsa-164944 nef and signal transduction
- R-hsa-199418 negative regulation of the pi3k akt network
- R-hsa-373753 nephrin family interactions
- R-hsa-9675108 nervous system development
- R-hsa-373752 netrin 1 signaling
- R-hsa-9032759 ntrk2 activates rac1
- R-hsa-9664407 parasite infection
- R-hsa-210990 pecam1 interactions
- R-hsa-2219528 pi3k akt signaling in cancer
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-75892 platelet adhesion to exposed collagen
- R-hsa-8866376 reelin signalling pathway
- R-hsa-9764561 regulation of cdh1 function
- R-hsa-9759476 regulation of homotypic cell cell adhesion
- R-hsa-1433559 regulation of kit signaling
- R-hsa-912631 regulation of signaling by cbl
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-2730905 role of lat2 ntal lab on calcium mobilization
- R-hsa-399954 sema3a pak dependent axon repulsion
- R-hsa-399955 sema3a plexin repulsion signaling by inhibiting integrin adhesion
- R-hsa-373755 semaphorin interactions
- R-hsa-9680350 signaling by csf1 m csf in myeloid cells
- R-hsa-1227986 signaling by erbb2
- R-hsa-449147 signaling by interleukins
- R-hsa-9669938 signaling by kit in disease
- R-hsa-9006115 signaling by ntrk2 trkb
- R-hsa-166520 signaling by ntrks
- R-hsa-9006934 signaling by receptor tyrosine kinases
- R-hsa-1433557 signaling by scf kit
- R-hsa-983705 signaling by the b cell receptor bcr
- R-hsa-194138 signaling by vegf
- R-hsa-164952 the role of nef in hiv 1 replication and disease pathogenesis
- R-hsa-9824446 viral infection pathways
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
45 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| FYN | CASR | P41180 | Y | 420 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:18065418 |
| FYN | PTK2B | Q14289 | Y | 420 | phosphorylation | NCI-PID_ProtMapperProtMapper | |
| FYN | PTPN6 | P29350 | Y | 420 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:8790380 |
| FYN | PTPN13 | Q12923 | Y | 420 | phosphorylation | NCI-PID_ProtMapperProtMapper | ProtMapper:11983165 |
| FYN | HTR6 | P50406 | Y | 420 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:22355260 |
| FYN | SOD3 | P08294 | Y | 420 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:25751262 |
| FYN | PTGER4 | P35408 | Y | 420 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:21900181 |
| FYN | PRKACB | P22694 | S | 21 | phosphorylation | Reactome_ProtMapperProtMapper | |
| FYN | PRKACG | P22612 | S | 21 | phosphorylation | Reactome_ProtMapperProtMapper | |
| FYN | TYK2 | P29597 | Y | 420 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:27521342 |
Ligand-Receptor Signaling
16 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | No | Yes | No | No | No |
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | No | No | No |
| adhesion | adhesion | OmniPath | Yes | Yes | No | No | No |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
Page 1 of 2Next
Regulatory Interaction Network
113 records.
Protein Complex Composition
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| ABL1DLGAP4FYNPIK3R1 | P00519P06241P27986Q9Y2H0 | 1:1:1:1 | CompleatCFinder | Compleat:HC4289 | ||
| FYN | P06241 | 2 | PDB | PDB:1g83PDB:3h0iPDB:4u17PDB:4znxPDB:7a2jPDB:2mrkPDB:7a2mPDB:7a2lPDB:3ua6PDB:1shfPDB:7a2nPDB:7a2k | ||
| FYNPIK3R1 | P06241P27986 | 1:1 | PDB | PDB:1a0nPDB:1azg |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryR Sequencing | 1 | 30865381 |
Sequence, Structure & Domains
Sequences
Length
537
Mass
60,762
Sequence
MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVALYDYEARTEDDLSFHKGEKFQILNSSEGDWWEARSLTTGETGYIPSNYVAPVDSIQAEEWYFGKLGRKDAERQLLSFGNPRGTFLIRESETTKGAYSLSIRDWDDMKGDHVKHYKIRKLDNGGYYITTRAQFETLQQLVQHYSERAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWMGTWNGNTKVAIKTLKPGTMSPESFLEEAQIMKKLKHDKLVQLYAVVSEEPIYIVTEYMNKGSLLDFLKDGEGRALKLPNLVDMAAQVAAGMAYIERMNYIHRDLRSANILVGNGLICKIADFGLARLIEDNEYTARQGAKFPIKWTAPEAALYGRFTIKSDVWSFGILLTELVTKGRVPYPGMNNREVLEQVERGYRMPCPQDCPISLHELMIHCWKKDPEERPTFEYLQSFLEDYFTATEPQYQPGENL
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; Synonyms=B; IsoId=P06241-1; Sequence=Displayed; Name=2; Synonyms=T; IsoId=P06241-2; Sequence=VSP_024110; Name=3; IsoId=P06241-3; Sequence=VSP_024108
Alternative Sequence
233..287; Missing (in isoform 3); 234..287; RAAGLCCRLVVPCHKGMPRLTDLSVKTKDVWEIPRESLQLIKRLGNGQFGEVWM -> KADGLCFNLTVIASSCTPQTSGLAKDAWEVARRSLCLEKKLGQGCFAEVWL (in isoform 2)
3D Structural Models
Turn
125..127; 165..167; 194..196; 209..211; 291..293; 303..305; 358..360; 400..402; 430..432
Helix
135..137; 141..143; 144..146; 156..163; 224..233; 268..270; 308..318; 350..354; 364..383; 393..395; 435..438; 445..460; 472..481; 496..502; 507..509; 513..521
Beta Strand
87..91; 97..100; 108..113; 115..124; 130..134; 138..140; 147..150; 172..177; 179..181; 185..193; 197..207; 213..216; 219..223; 238..240; 263..265; 271..278; 285..290; 294..299; 329..333; 335..337; 339..343; 355..357; 396..399; 403..406; 416..418
3D Structure
NMR spectroscopy (11); X-ray crystallography (40)
Domain & Motif Annotations
Domain (FT)
82..143; SH3; 149..246; SH2; 271..524; Protein kinase
Region
14..35; Disordered
Protein Families
- Protein kinase superfamily
- Tyr protein kinase family
- SRC subfamily
Sequence Similarities
Belongs to the protein kinase superfamily. Tyr protein kinase family. SRC subfamily.
Clinical Relevance
Disease Involvement
Proto-oncogene
Related Diseases
Biomarker
Phase 2; Approved; Phase 1
Drug Targets
Literature-reported target
Drugs
CYC-116AST-4871-AZAKENPAULLONEVANDETANIBZM447439TG100-801CHEMBL:CHEMBL379975DASATINIB ANHYDROUSXL-228PAZOPANIBHM50316BARASERTIBCP-547632NVP-TAE684PD-0166285ENMD-981693ILORASERTIBALDESLEUKINDOVITINIBPP2ADAVOSERTIBKENPAULLONEENTRECTINIBRG-1530JNJ-26483327HESPERADINTAMATINIBENMD-2076PF-562271TOZASERTIBCHEMBL:CHEMBL546797CEDIRANIBCOMPOUND 13 [PMID: 17502136]CENISERTIBRECOMBINANT VASCULAR ENDOTHELIAL GROWTH FACTORBINDARIT
Interaction Protein
ENSG00000005020ENSG00000015285ENSG00000050820ENSG00000065675ENSG00000076641ENSG00000080824ENSG00000082074ENSG00000096384ENSG00000100842ENSG00000105401ENSG00000110395ENSG00000117560ENSG00000120899ENSG00000121774ENSG00000134909ENSG00000142949ENSG00000143537ENSG00000145335ENSG00000169398ENSG00000186868ENSG00000197122
Interaction Count
21
Interaction Dataset
intact_biogrid