Protein detail
S10A6
Protein S100-A6 (Calcyclin) (Growth factor-inducible protein 2A9) (MLN 4) (Prolactin receptor-associated protein) (PRA) (S100 calcium-binding protein A6)
Entry name S10A6 | UniProt ID | EVMP confidence score 0.60 |
Supporting publications (n) 12 | Transmembrane count | Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Protein S100-A6 (Calcyclin) (Growth factor-inducible protein 2A9) (MLN 4) (Prolactin receptor-associated protein) (PRA) (S100 calcium-binding protein A6)
Protein Class (3)
Cancer-related genesPlasma proteinsPredicted intracellular proteins
Protein Function (2)
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
2A9CABPCACYPRA
Gene Description
S100 calcium binding protein A6
Chromosome
1
Position
153534599-153536244
Supporting publications (n)
12
EVMP confidence score
0.60
Fluorescence & Localization
Tissue SpecificintestineCell SpecificColonocytes
Function & Pathway
Protein Function (2)
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Cellular Component (11)
- GO:0001726 ruffle
- GO:0005576 extracellular region
- GO:0005634 nucleus
- GO:0005635 nuclear envelope
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0048471 perinuclear region of cytoplasm
- GO:0062023 collagen-containing extracellular matrix
Page 1 of 2
Molecular Function (8)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence14
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| ligand | ligand | Matrisome | Yes | Yes | |||
| ligand | ligand | OmniPath | Yes | Yes |
Page 2 of 2Previous
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra]R Sequencing | 1 | 37953466 |
Sequence, Structure & Domains
Sequences
Length
90
Mass
10,180
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
3D Structural Models
Turn
63..65
Helix
4..20; 31..41; 45..47; 51..62; 70..84; 86..88
Beta Strand
22..24; 28..30; 67..69
3D Structure
NMR spectroscopy (1); X-ray crystallography (5)
Domain & Motif Annotations
Domain (FT)
12..47; EF-hand 1; 48..83; EF-hand 2
Protein Families
S-100 family
Sequence Similarities
Belongs to the S-100 family.
Clinical Relevance
Supporting Publications12
| PMID | Title | Related sentences |
|---|---|---|
| 28590090 | Motile hepatocellular carcinoma cells preferentially secret sugar metabolism regulatory proteins via exosomes. | No related sentences available |
| 28986585 | Quantitation of putative colorectal cancer biomarker candidates in serum extracellular vesicles by targeted proteomics. | No related sentences available |
| 32089743 | Human umbilical cord mesenchymal stromal cells-derived extracellular vesicles exert potent bone protective effects by CLEC11A-mediated regulation of bone metabolism. | No related sentences available |
| 33035814 | Knockout of PRDX6 induces mitochondrial dysfunction and cell cycle arrest at G2/M in HepG2 hepatocarcinoma cells. | No related sentences available |
| 33709510 | Unbiased proteomic profiling of host cell extracellular vesicle composition and dynamics upon HIV-1 infection. | No related sentences available |
| 34186243 | A Reductionist Approach Using Primary and Metastatic Cell-Derived Extracellular Vesicles Reveals Hub Proteins Associated with Oral Cancer Prognosis. | No related sentences available |
| 37205098 | Proteomic profiling of extracellular vesicles in synovial fluid and plasma from Oligoarticular Juvenile Idiopathic Arthritis patients reveals novel immunopathogenic biomarkers. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38321535 | Identification of specific markers for human pluripotent stem cell-derived small extracellular vesicles. | No related sentences available |
| 39409015 | SILAC-Based Characterization of Plasma-Derived Extracellular Vesicles in Patients Undergoing Partial Hepatectomy. | No related sentences available |
Page 1 of 2Next