Protein detail
S10A6
Protein S100-A6 (Calcyclin) (Growth factor-inducible protein 2A9) (MLN 4) (Prolactin receptor-associated protein) (PRA) (S100 calcium-binding protein A6)
Entry name S10A6 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 12 | Transmembrane count | Protein classification Cancer-related genesPlasma proteinsPredicted intracellular proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information11
Protein Names
Protein S100-A6 (Calcyclin) (Growth factor-inducible protein 2A9) (MLN 4) (Prolactin receptor-associated protein) (PRA) (S100 calcium-binding protein A6)
Protein Class (3)
Cancer-related genesPlasma proteinsPredicted intracellular proteins
Protein Function (2)
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
2A9CABPCACYPRA
Gene Description
S100 calcium binding protein A6
Chromosome
1
Position
153534599-153536244
Supporting publications (n)
12
EVMP confidence score
0.72
Fluorescence & Localization2
Tissue SpecificintestineCell SpecificColonocytes
Function & Pathway6
Protein Function (2)
- Cancer-related genes:Candidate cancer biomarkers
- Predicted intracellular proteins
Cellular Component (11)
- GO:0001726 ruffle
- GO:0005576 extracellular region
- GO:0005634 nucleus
- GO:0005635 nuclear envelope
- GO:0005737 cytoplasm
- GO:0005829 cytosol
- GO:0005886 plasma membrane
- GO:0009898 cytoplasmic side of plasma membrane
- GO:0048471 perinuclear region of cytoplasm
- GO:0062023 collagen-containing extracellular matrix
Page 1 of 2
Molecular Function (8)
Biological Process (3)
Mediation Categories
Other mediation
Relations & Evidence14
Ligand-Receptor Signaling (12)
12 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| extracellular | extracellular | OmniPath | No | No | Yes | No | No |
| intracellular | intracellular | LOCATE | No | No | Yes | No | No |
| intracellular | intracellular | ComPPI | No | No | Yes | No | No |
| intracellular | intracellular | GO_Intercell | No | No | Yes | No | No |
| intracellular | intracellular | UniProt_location | No | No | Yes | No | No |
| intracellular | intracellular | OmniPath | No | No | Yes | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | No | No |
| secreted | secreted | Matrisome | No | No | Yes | No | No |
| secreted | secreted | OmniPath | No | No | Yes | No | No |
Page 1 of 2Next
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometryMass spectrometry [LTQ-FT Ultra]R Sequencing | 1 | 37953466 |
Sequence, Structure & Domains10
Sequences
Length
90
Mass
10,180
Sequence
MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG
3D Structural Models
Turn
63..65
Helix
4..20; 31..41; 45..47; 51..62; 70..84; 86..88
Beta Strand
22..24; 28..30; 67..69
3D Structure
NMR spectroscopy (1); X-ray crystallography (5)
Domain & Motif Annotations
Domain (FT)
12..47; EF-hand 1; 48..83; EF-hand 2
Protein Families
S-100 family
Sequence Similarities
Belongs to the S-100 family.
Clinical Relevance5
Supporting Publications12
| PMID | Title | Abstract |
|---|---|---|
| 39573935 | Time-Lapse Acquisition of Both Freely Secreted Proteome and Exosome Encapsulated Proteome in Live Organoids' Microenvironment. | No abstract available |
| 40748658 | Exosomes released from senescent cells and circulatory exosomes isolated from human plasma reveal aging-associated proteomic and lipid signatures. | No abstract available |
Page 2 of 2Previous