Protein detail
FCER2
Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form]
Entry name FCER2 | UniProt ID | EVMP confidence score 0.38 |
Supporting publications (n) 6 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Low affinity immunoglobulin epsilon Fc receptor (BLAST-2) (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor) (CD antigen CD23) [Cleaved into: Low affinity immunoglobulin epsilon Fc receptor membrane-bound form; Low affinity immunoglobulin epsilon Fc receptor soluble form]
Protein Class (5)
Cancer-related genesCD markersPredicted intracellular proteinsPredicted membrane proteinsPredicted secreted proteins
Protein Function (4)
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- CD markers
- Predicted intracellular proteins
Transmembrane
22..47; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (6)
CD23CD23ACLEC4JFCE2FcepsilonRIIFCErII
Gene Description
Fc epsilon receptor II
Chromosome
19
Position
7688758-7702146
Supporting publications (n)
6
EVMP confidence score
0.38
Fluorescence & Localization3
Cell SpecificEpendymal cellsBlood Cell Specificintermediate monocyteBlood Lineage Specificmonocytes
Function & Pathway8
Protein Function (4)
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- CD markers
- Predicted intracellular proteins
Cellular Component (3)
Molecular Function (8)
Biological Process (3)
Reactome (7)
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-6783783 interleukin 10 signaling
- R-hsa-6785807 interleukin 4 and interleukin 13 signaling
- R-hsa-2197563 notch2 intracellular domain regulates transcription
- R-hsa-449147 signaling by interleukins
- R-hsa-157118 signaling by notch
- R-hsa-1980145 signaling by notch2
Canonical Pathways (3)
- M138 Pid thrombin par4 pathway
- M155 Pid s1p meta pathway
- M268 Pid s1p s1p2 pathway
Mediation Categories (4)
Adhesion and uptake mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence49
Ligand-Receptor Signaling (46)
46 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | Almen2009 | No | Yes | Yes | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | Yes | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | Yes | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | No |
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 | No | No | Yes | Yes | No |
Page 5 of 5Previous
Protein Complex Composition (2)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 32230970 |
Sequence, Structure & Domains10
Sequences
Length
321
Mass
36,469
Sequence
MEEGQYSEIEELPRRRCCRRGTQIVLLGLVTAALWAGLLTLLLLWHWDTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS
3D Structural Models
Turn
227..230; 247..252; 253..256
Helix
184..193; 204..211
Beta Strand
159..162; 164..166; 168..170; 173..182; 196..198; 215..217; 219..226; 231..234; 259..262; 264..266; 268..271; 277..285; 287..289; 291..294
3D Structure
NMR spectroscopy (2); X-ray crystallography (21)
Domain & Motif Annotations
Repeat
69..89; 90..110; 111..131
Domain (FT)
162..284; C-type lectin
Region
66..85; Disordered; 290..321; Disordered
Clinical Relevance3
Disease Involvement
Cancer-related genes
Drugs (5)
Supporting Publications6
| PMID | Title | Abstract |
|---|---|---|
| 24505114 | Proteomics analysis of cancer exosomes using a novel modified aptamer-based array (SOMAscan™) platform. | These included proteins of known association with cancer exosomes such as MFG-E8, integrins, and MET, and also those less widely reported as exosomally associated, such as ROR1 and ITIH4. |
| 29562735 | Altered Proteome of Extracellular Vesicles Derived from Bladder Cancer Patients Urine. | No abstract available |
| 30071318 | Changes in the urinary extracellular vesicle proteome are associated with nephronophthisis-related ciliopathies. | No abstract available |
| 31588238 | Dual-platform affinity proteomics identifies links between the recurrence of ovarian carcinoma and proteins released into the tumor microenvironment. | No abstract available |
| 36635400 | Proteomic profiling of urinary small extracellular vesicles in children with pneumonia: a pilot study. | No abstract available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No abstract available |