Protein detail
CD3E
T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)
Entry name CD3E | UniProt ID | EVMP confidence score 0.53 |
Supporting publications (n) 3 | Transmembrane count 1 | Protein classification CD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
T-cell surface glycoprotein CD3 epsilon chain (T-cell surface antigen T3/Leu-4 epsilon chain) (CD antigen CD3e)
Protein Class (6)
CD markersDisease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteinsTransporters
Protein Function (5)
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- FDA approved drug targets:Biotech drugs
Transmembrane
127..152; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
CD3-epsilonCD3epsilon
Gene Description
CD3 epsilon subunit of T-cell receptor complex
Chromosome
11
Position
118304730-118316175
Supporting publications (n)
3
EVMP confidence score
0.53
Fluorescence & Localization
Tissue SpecificbrainCell SpecificAdipocytes
Function & Pathway
Protein Function (5)
- CD markers
- Human disease related genes:Immune system diseases:Primary immunodeficiency
- Transporters:Accessory Factors Involved in Transport
- Disease related genes
- FDA approved drug targets:Biotech drugs
Cellular Component (11)
- GO:0001772 immunological synapse
- GO:0005783 endoplasmic reticulum
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0005911 cell-cell junction
- GO:0009897 external side of plasma membrane
- GO:0042101 T cell receptor complex
- GO:0042105 alpha-beta T cell receptor complex
- GO:0042106 gamma-delta T cell receptor complex
- GO:0043197 dendritic spine
Page 1 of 2
Molecular Function (7)
Biological Process (3)
KEGG (11)
- hsa04640 Hematopoietic cell lineage
- KEGG:hsa04658 Th1 and Th2 cell differentiation
- KEGG:hsa04659 Th17 cell differentiation
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa05142 Chagas disease
- KEGG:hsa05162 Measles
- KEGG:hsa05166 Human T-cell leukemia virus 1 infection
- KEGG:hsa05169 Epstein-Barr virus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
Page 1 of 2
Reactome (8)
- R-hsa-1280218 adaptive immune system
- R-hsa-389948 co inhibition by pd 1
- R-hsa-202424 downstream tcr signaling
- R-hsa-202433 generation of second messenger molecules
- R-hsa-198933 immunoregulatory interactions between a lymphoid and a non lymphoid cell
- R-hsa-202427 phosphorylation of cd3 and tcr zeta chains
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-202403 tcr signaling
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence44
Enzyme-Mediated Modification (6)
6 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD3E | LCK | P06239 | Y | 199 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | SIGNOR:11855827KEA:15659558KEA:15144186KEA:16094384ProtMapper:11855827KEA:15592455HPRD:11855827KEA:11855827KEA:12522270 |
| CD3E | LCK | P06239 | Y | 188 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | SIGNOR:11855827KEA:15659558KEA:16094384ProtMapper:11855827KEA:15592455HPRD:11855827KEA:11855827 |
| CD3E | SRC | P12931 | Y | 188 | phosphorylation | Li2012 | |
| CD3E | SRC | P12931 | Y | 199 | phosphorylation | Li2012 | |
| CD3E | FYN | P06241 | Y | 199 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper | |
| CD3E | FYN | P06241 | Y | 188 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperPhosphoSitePhosphoSite_ProtMapper |
Ligand-Receptor Signaling (27)
27 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_predicted | transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane | GO_Intercell | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes | ||||
| transmembrane | transmembrane | LOCATE | Yes | ||||
| transmembrane | transmembrane | Ramilowski_location | Yes | ||||
| transmembrane | transmembrane | OmniPath | Yes | ||||
| plasma_membrane | plasma_membrane | UniProt_location | Yes | ||||
| plasma_membrane | plasma_membrane | OmniPath | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | Membranome | Yes | ||||
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | Yes |
Regulatory Interaction Network (6)
6 records.
Protein Complex Composition (4)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Western blotting | 1 | 30646616 |
Sequence, Structure & Domains
Sequences
Length
207
Mass
23,147
Sequence
MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRRI
3D Structural Models
Helix
24..26; 89..92; 105..107; 127..155; 193..195
Beta Strand
37..41; 44..48; 51..55; 57..61; 64..69; 75..78; 81..84; 94..100; 101..103; 110..116; 120..123
3D Structure
Electron microscopy (28); NMR spectroscopy (1); X-ray crystallography (6)
Domain & Motif Annotations
Domain (FT)
32..112; Ig-like; 178..205; ITAM
Region
161..207; Disordered; 175..192; NUMB-binding region; 179..186; Proline-rich sequence
Clinical Relevance
Disease Involvement
FDA approved drug targets
Related Diseases (6)
Biomarker
Phase 2; Phase 1/2; Phase 1; Approved
Drug Targets
FDA approved drug targets
Drugs (36)
TEPLIZUMABBLINATUMOMABNULLCATUMAXOMABGLOFITAMABRESIMMUNEMEDI-565MUROMONAB-CD3ELRANATAMABANTI-CD3 MONOCLONAL ANTIBODYERTUMAXOMABSOLITOMABOTELIXIZUMABVISILIZUMABHOKT3EMPAGLIFLOZINMOSUNETUZUMABCANAGLIFLOZINFORALUMABODRONEXTAMABERTUGLIFLOZINREMOGLIFLOZINEPCORITAMABIPRAGLIFLOZINSOTAGLIFLOZINTOFOGLIFLOZIN ANHYDROUSDAPAGLIFLOZIN PROPANEDIOLBEXAGLIFLOZINIMC-GP100TECLISTAMAB-CQYVFLOTETUZUMABLICOGLIFLOZINTALQUETAMABFBT-A05SERGLIFLOZINENAVOGLIFLOZIN
Interaction Protein (3)
ENSG00000071051ENSG00000131037ENSG00000158092
Interaction Count
3
Interaction Dataset
intact_biogrid
Supporting Publications3
| PMID | Title | Related sentences |
|---|---|---|
| 27894104 | Proteomic profiling of NCI-60 extracellular vesicles uncovers common protein cargo and cancer type-specific biomarkers. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 40748658 | Exosomes released from senescent cells and circulatory exosomes isolated from human plasma reveal aging-associated proteomic and lipid signatures. | No related sentences available |