Protein detail
4F2
Amino acid transporter heavy chain SLC3A2 (4F2 cell-surface antigen heavy chain) (4F2hc) (4F2 heavy chain antigen) (Lymphocyte activation antigen 4F2 large subunit) (Solute carrier family 3 member 2) (CD antigen CD98)
Entry name 4F2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification Cancer-related genesCD markersEssential proteinsMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Amino acid transporter heavy chain SLC3A2 (4F2 cell-surface antigen heavy chain) (4F2hc) (4F2 heavy chain antigen) (Lymphocyte activation antigen 4F2 large subunit) (Solute carrier family 3 member 2) (CD antigen CD98)
Protein Class (8)
Cancer-related genesCD markersEssential proteinsMetabolic proteinsPlasma proteinsPredicted intracellular proteinsPredicted membrane proteinsTransporters
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Transporters:Electrochemical Potential-driven transporters
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
84..104; Helical; Signal-anchor for type II membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (7)
4F24F2HC4T2HCCD98CD98HCMDU1NACAE
Gene Description
Solute carrier family 3 member 2
Chromosome
11
Position
62856004-62888880
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificCardiomyocytesSingle-Nuclei Brain Specificamygdala excitatory
Function & Pathway8
Protein Function (5)
- Predicted intracellular proteins
- CD markers
- Transporters:Electrochemical Potential-driven transporters
- Cancer-related genes:Candidate cancer biomarkers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (14)
- GO:0005654 nucleoplasm
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0009925 basal plasma membrane
- GO:0009986 cell surface
- GO:0016020 membrane
- GO:0016323 basolateral plasma membrane
- GO:0016324 apical plasma membrane
- GO:0042470 melanosome
- GO:0044225 apical pole of neuron
Page 1 of 2
Molecular Function (14)
- GO:0001618 virus receptor activity
- GO:0003723 RNA binding
- GO:0003725 double-stranded RNA binding
- GO:0005294 neutral L-amino acid secondary active transmembrane transporter activity
- GO:0005432 calcium:sodium antiporter activity
- GO:0005515 protein binding
- GO:0015173 aromatic amino acid transmembrane transporter activity
- GO:0015175 neutral L-amino acid transmembrane transporter activity
- GO:0015180 L-alanine transmembrane transporter activity
- GO:0015190 L-leucine transmembrane transporter activity
Page 1 of 2
Biological Process (3)
KEGG (3)
Reactome (10)
- R-hsa-210991 basigin interactions
- R-hsa-202733 cell surface interactions at the vascular wall
- R-hsa-5619115 disorders of transmembrane transporters
- R-hsa-109582 hemostasis
- R-hsa-71291 metabolism of amino acids and derivatives
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-9958863 slc mediated transport of amino acids
- R-hsa-5619102 slc transporter disorders
- R-hsa-382551 transport of small molecules
- R-hsa-71240 tryptophan catabolism
Canonical Pathways
M186 Pid pdgfrb pathway
Mediation Categories (4)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence59
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC3A2 | CSNK2A1 | P68400 | S | 408 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SLC3A2 | CSNK2A1 | P68400 | S | 527 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SLC3A2 | CSNK2A1 | P68400 | S | 406 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SLC3A2 | CSNK2A1 | P68400 | S | 531 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SLC3A2 | CSNK2A1 | P68400 | S | 410 | phosphorylation | PhosphoSitePhosphoSite_ProtMapperProtMapper | |
| SLC3A2 | CSNK2A1 | P68400 | S | 407 | phosphorylation | MIMPPhosphoSite_MIMP | |
| SLC3A2 | CSNK2A1 | P68400 | S | 409 | phosphorylation | MIMPPhosphoSite_MIMP | |
| SLC3A2 | CSNK2A1 | P68400 | S | 411 | phosphorylation | MIMPPhosphoSite_MIMP | |
| SLC3A2 | CSNK2A1 | P68400 | S | 528 | phosphorylation | MIMPPhosphoSite_MIMP | |
| SLC3A2 | CSNK2A1 | P68400 | S | 532 | phosphorylation | MIMPPhosphoSite_MIMP |
Ligand-Receptor Signaling (41)
41 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| plasma_membrane | plasma_membrane | Ramilowski_location | No | No | No | Yes | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | CSPA | No | No | No | Yes | No |
| plasma_membrane_transmembrane | plasma_membrane_transmembrane | OmniPath | No | No | No | Yes | No |
| cell_surface | cell_surface | Surfaceome | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | scConnect | No | Yes | No | Yes | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
| transmembrane_sosui | transmembrane_predicted | Almen2009 | No | No | No | Yes | No |
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MARH8 | Q5T0T0 | 4F2 | P08195 | Yes | No | Yes | SIGNOR | SIGNOR:21757542 |
| CSK21 | P68400 | 4F2 | P08195 | Yes | No | No | PhosphoSite_MIMPMIMPPhosphoSite_norefiPTMnetProtMapperPhosphoSitePhosphoSite_ProtMapper | PhosphoSite:19065266 |
Protein Complex Composition (5)
5 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster104 | AZU1MLECPRTN3SLC3A2 | P08195P20160P24158Q14165 | 1:1:1:1 | Compleat | Compleat:HC1882 | 22036573 |
| Y+LAT1-4F2 heteromeric amino acid transporter complex | SLC3A2SLC7A7 | P08195Q9UM01 | 1:1 | ComplexPortalPDB | PDB:9kjuPDB:8ylpintact:EBI-46442638 | 98780491131113518688235368306701475529223940088 |
| A0A5C2G3X0SLC3A2 | A0A5C2G3X0P08195 | 4:4 | PDB | PDB:7df1 | ||
| SLC3A2 | P08195 | 2 | PDB | PDB:2dh3 | ||
| LCN2SLC3A2 | P08195P80188 | 2:2 | PDB | PDB:6s8v |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Western blotting | 1 | 37922300 |
Sequence, Structure & Domains12
Sequences
Length
529
Mass
57,945
Sequence
MSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLVKIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVIIVRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAA
Alternative Products
Event=Alternative splicing; Named isoforms=4; Name=2; IsoId=P08195-2; Sequence=Displayed; Name=1; IsoId=P08195-1; Sequence=VSP_062646; Name=3; IsoId=P08195-3; Sequence=VSP_062647; Name=5; IsoId=P08195-5; Sequence=VSP_062648
Alternative Sequence
1; M -> MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSELGSHCVAQTGLELLASGDPLPSASQNAEMIETGSDCVTQAGLQLLASSDPPALASKNAEVTGTM (in isoform 1); 1; M -> MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSGTM (in isoform 3); 1; M -> MELQPPEASIAVVSIPRQLPGSHSEAGVQGLSAGDDSETGSDCVTQAGLQLLASSDPPALASKNAEVTVETGFHHVSQADIEFLTSIDPTASASGSAGITGTM (in isoform 5)
3D Structural Models
Turn
171..173; 209..212; 292..294; 325..327
Helix
66..72; 77..80; 82..105; 117..119; 129..133; 135..137; 140..144; 147..152; 181..183; 186..198; 222..239; 249..251; 255..269; 284..291; 311..324; 340..342; 346..348; 349..356; 369..371; 375..377; 392..394; 399..401; 404..406; 408..412; 418..429; 433..437; 479..481; 484..486; 510..512
Beta Strand
74..76; 123..126; 156..160; 164..166; 174..179; 202..206; 213..215; 218..220; 243..246; 252..254; 274..278; 298..300; 302..304; 305..307; 330..332; 336..338; 359..366; 378..380; 383..385; 396..398; 415..417; 439..442; 446..448; 449..455; 457..459; 461..467; 469..471; 490..502; 506..509; 520..525
3D Structure
Electron microscopy (38); X-ray crystallography (5)
Domain & Motif Annotations
Region
15..39; Disordered
Protein Families
SLC3A transporter family
Sequence Similarities
Belongs to the SLC3A transporter family.
Clinical Relevance9
Disease Involvement
Cancer-related genes
Related Diseases
Biomarker
Phase 1
Drug Targets
Clinical trial target
Drugs
Interaction Protein (8)
ENSG00000103064ENSG00000103257ENSG00000103769ENSG00000127022ENSG00000151012ENSG00000155465ENSG00000163399ENSG00000170775
Interaction Count
8
Interaction Dataset (3)
biogrid_opencellintact_biogrid_opencellintact_biogrid
Supporting Publications2
| PMID | Title | Abstract |
|---|---|---|
| 38343172 | Analysis of secreted small extracellular vesicles from activated human microglial cell lines reveals distinct pro- and anti-inflammatory proteomic profiles. | No abstract available |
| 40222457 | Proteome alterations in peripheral immune cells of DLBCL patients and evidence of cancer extracellular vesicles involvement. | No abstract available |