Protein detail
ITA2B
Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) [Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2]
Protein symbol ITA2B | UniProt ID | EVMP score 0.63 |
Frequency 9 | Transmembrane count 1 | Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
Basic Information
Protein Names
Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) [Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2]
Protein Class
Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- CD markers
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Transmembrane
994..1019; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
CD41CD41BGP2BPPP1R93
Gene Description
Integrin subunit alpha 2b
Chromosome
17
Position
44372180-44389649
Frequency
9
EVMP Score
0.63
Fluorescence & Localization
Function & Pathway
Protein Function
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- CD markers
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04015 Rap1 signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04613 Neutrophil extracellular trap formation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04820 Cytoskeleton in muscle cells
- KEGG:hsa05165 Human papillomavirus infection
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05222 Small cell lung cancer
- KEGG:hsa05410 Hypertrophic cardiomyopathy
- KEGG:hsa05412 Arrhythmogenic right ventricular cardiomyopathy
- KEGG:hsa05414 Dilated cardiomyopathy
- KEGG:hsa05418 Fluid shear stress and atherosclerosis
Reactome
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-3000178 ecm proteoglycans
- R-hsa-1474244 extracellular matrix organization
- R-hsa-354194 grb2 sos provides linkage to mapk signaling for integrins
- R-hsa-109582 hemostasis
- R-hsa-216083 integrin cell surface interactions
- R-hsa-354192 integrin signaling
- R-hsa-373760 l1cam interactions
- R-hsa-5674135 map2k and mapk activation
- R-hsa-5684996 mapk1 mapk3 signaling
- R-hsa-5683057 mapk family signaling cascades
- R-hsa-9675108 nervous system development
- R-hsa-6802957 oncogenic mapk signaling
- R-hsa-372708 p130cas linkage to mapk signaling for integrins
- R-hsa-76002 platelet activation signaling and aggregation
- R-hsa-76009 platelet aggregation plug formation
- R-hsa-76005 response to elevated platelet cytosolic ca2
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-8936459 runx1 regulates genes involved in megakaryocyte differentiation and platelet function
- R-hsa-6802952 signaling by braf and raf1 fusions
- R-hsa-6802946 signaling by moderate kinase activity braf mutants
- R-hsa-445144 signal transduction by l1
- R-hsa-8878171 transcriptional regulation by runx1
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
63 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | CellPhoneDB | No | Yes | No | Yes | No |
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | HPMR | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Surfaceome | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| integrin | receptor | Integrins | No | Yes | No | Yes | No |
| integrin | receptor | UniProt_keyword | No | Yes | No | Yes | No |
Page 1 of 7Next
Regulatory Interaction Network
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CIB1 | Q99828 | ITA2B | P08514 | Yes | Yes | No | MPPISIGNORHPRDHINTLMPIDLit-BM-17 | HINT:9030514LMPID:20034469LMPID:9030514HPRD:9030514Lit-BM-17:9030514HINT:10358085MPPI:10358085SIGNOR:11756406 |
Protein Complex Composition
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryR Sequencing | 1 | 23161513 |
Sequence, Structure & Domains
Sequences
Length
1,039
Mass
113,377
Sequence
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08514-1; Sequence=Displayed; Name=2; IsoId=P08514-2; Sequence=VSP_002737; Name=3; Synonyms=tr-alpha-IIb; IsoId=P08514-3; Sequence=VSP_002736
Alternative Sequence
910..1039; SCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE -> VSRLSGLWPGLPGTHGAEGMGGGRGVRVCCGPLWATLGPWEHFK (in isoform 3); 948..981; Missing (in isoform 2)
3D Structural Models
Turn
166..169; 189..193; 349..351; 413..416; 542..544; 555..557; 634..637; 911..913; 991..994; 996..1001; 1035..1038
Helix
183..188; 219..222; 231..237; 259..261; 291..294; 471..473; 547..549; 586..588; 698..700; 742..744; 942..945; 1002..1015; 1028..1031
Beta Strand
36..38; 40..43; 52..58; 60..62; 64..70; 78..80; 82..88; 91..94; 107..110; 113..118; 126..131; 134..139; 143..148; 151..153; 159..165; 170..174; 202..206; 208..210; 211..216; 225..230; 268..273; 279..281; 283..288; 297..301; 307..312; 314..318; 324..327; 330..333; 336..341; 345..348; 352..355; 358..362; 366..368; 375..379; 391..398; 400..402; 404..409; 419..423; 427..430; 435..439; 450..456; 461..463; 465..470; 475..479; 484..493; 495..497; 507..509; 512..525; 534..541; 551..554; 559..567; 575..583; 592..594; 596..603; 616..619; 622..627; 643..651; 653..655; 662..670; 678..683; 688..695; 705..708; 710..713; 715..721; 728..738; 746..755; 759..761; 767..774; 779..792; 810..819; 821..823; 825..836; 842..854; 856..861; 906..909; 916..926; 931..940; 952..965; 967..969; 977..988; 1019..1027
3D Structure
Electron microscopy (12); NMR spectroscopy (13); X-ray crystallography (50)
Domain & Motif Annotations
Repeat
35..96; FG-GAP 1; 110..173; FG-GAP 2; 187..238; FG-GAP 3; 251..305; FG-GAP 4; 306..371; FG-GAP 5; 373..432; FG-GAP 6; 435..496; FG-GAP 7
Motif
1022..1026; GFFKR motif
Protein Families
Integrin alpha chain family
Sequence Similarities
Belongs to the integrin alpha chain family.
Clinical Relevance
Disease Involvement
Cancer-related genesDisease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs
Interaction Protein
ENSG00000259207
Interaction Count
1
Interaction Dataset
intact_biogrid