Protein detail
ITA2B
Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) [Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2]
Entry name ITA2B | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 9 | Transmembrane count 1 | Protein classification Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Integrin alpha-IIb (GPalpha IIb) (GPIIb) (Platelet membrane glycoprotein IIb) (CD antigen CD41) [Cleaved into: Integrin alpha-IIb heavy chain; Integrin alpha-IIb light chain, form 1; Integrin alpha-IIb light chain, form 2]
Protein Class (9)
Cancer-related genesCandidate cardiovascular disease genesCD markersDisease related genesFDA approved drug targetsHuman disease related genesPlasma proteinsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- CD markers
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Transmembrane
994..1019; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
CD41CD41BGP2BPPP1R93
Gene Description
Integrin subunit alpha 2b
Chromosome
17
Position
44372180-44389649
Supporting publications (n)
9
EVMP confidence score
0.63
Function & Pathway7
Protein Function (8)
- Human disease related genes:Cardiovascular diseases:Hematologic diseases
- Predicted intracellular proteins
- CD markers
- Candidate cardiovascular disease genes
- Cancer-related genes:Candidate cancer biomarkers
- Disease related genes
- FDA approved drug targets:Small molecule drugs
- FDA approved drug targets:Biotech drugs
Cellular Component (9)
Molecular Function (7)
Biological Process (3)
KEGG (17)
- hsa04015 Rap1 signaling pathway
- KEGG:hsa04151 PI3K-Akt signaling pathway
- KEGG:hsa04510 Focal adhesion
- KEGG:hsa04512 ECM-receptor interaction
- KEGG:hsa04518 Integrin signaling
- KEGG:hsa04611 Platelet activation
- KEGG:hsa04613 Neutrophil extracellular trap formation
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04810 Regulation of actin cytoskeleton
- KEGG:hsa04820 Cytoskeleton in muscle cells
Page 1 of 2
Reactome (23)
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-3000178 ecm proteoglycans
- R-hsa-1474244 extracellular matrix organization
- R-hsa-354194 grb2 sos provides linkage to mapk signaling for integrins
- R-hsa-109582 hemostasis
- R-hsa-216083 integrin cell surface interactions
- R-hsa-354192 integrin signaling
- R-hsa-373760 l1cam interactions
- R-hsa-5674135 map2k and mapk activation
- R-hsa-5684996 mapk1 mapk3 signaling
Page 1 of 3
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence66
Ligand-Receptor Signaling (63)
63 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | connectomeDB2020 | No | No | No | Yes | No |
| cell_surface | cell_surface | OmniPath | No | No | No | Yes | No |
| receptor | receptor | talklr | No | Yes | No | Yes | No |
| receptor | receptor | Cellinker | No | Yes | No | Yes | No |
| receptor | receptor | scConnect | No | Yes | No | Yes | No |
| receptor | receptor | connectomeDB2020 | No | Yes | No | Yes | No |
| receptor | receptor | iTALK | No | Yes | No | Yes | No |
| receptor | receptor | Almen2009 | No | Yes | No | Yes | No |
| receptor | receptor | CellCellInteractions | No | Yes | No | Yes | No |
| receptor | receptor | EMBRACE | No | Yes | No | Yes | No |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| CIB1 | Q99828 | ITA2B | P08514 | Yes | Yes | No | MPPISIGNORHPRDHINTLMPIDLit-BM-17 | HINT:9030514LMPID:20034469LMPID:9030514HPRD:9030514Lit-BM-17:9030514HINT:10358085MPPI:10358085SIGNOR:11756406 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryR Sequencing | 1 | 23161513 |
Sequence, Structure & Domains13
Sequences
Length
1,039
Mass
113,377
Sequence
MARALCPLQALWLLEWVLLLLGPCAAPPAWALNLDPVQLTFYAGPNGSQFGFSLDFHKDSHGRVAIVVGAPRTLGPSQEETGGVFLCPWRAEGGQCPSLLFDLRDETRNVGSQTLQTFKARQGLGASVVSWSDVIVACAPWQHWNVLEKTEEAEKTPVGSCFLAQPESGRRAEYSPCRGNTLSRIYVENDFSWDKRYCEAGFSSVVTQAGELVLGAPGGYYFLGLLAQAPVADIFSSYRPGILLWHVSSQSLSFDSSNPEYFDGYWGYSVAVGEFDGDLNTTEYVVGAPTWSWTLGAVEILDSYYQRLHRLRGEQMASYFGHSVAVTDVNGDGRHDLLVGAPLYMESRADRKLAEVGRVYLFLQPRGPHALGAPSLLLTGTQLYGRFGSAIAPLGDLDRDGYNDIAVAAPYGGPSGRGQVLVFLGQSEGLRSRPSQVLDSPFPTGSAFGFSLRGAVDIDDNGYPDLIVGAYGANQVAVYRAQPVVKASVQLLVQDSLNPAVKSCVLPQTKTPVSCFNIQMCVGATGHNIPQKLSLNAELQLDRQKPRQGRRVLLLGSQQAGTTLNLDLGGKHSPICHTTMAFLRDEADFRDKLSPIVLSLNVSLPPTEAGMAPAVVLHGDTHVQEQTRIVLDCGEDDVCVPQLQLTASVTGSPLLVGADNVLELQMDAANEGEGAYEAELAVHLPQGAHYMRALSNVEGFERLICNQKKENETRVVLCELGNPMKKNAQIGIAMLVSVGNLEEAGESVSFQLQIRSKNSQNPNSKIVLLDVPVRAEAQVELRGNSFPASLVVAAEEGEREQNSLDSWGPKVEHTYELHNNGPGTVNGLHLSIHLPGQSQPSDLLYILDIQPQGGLQCFPQPPVNPLKVDWGLPIPSPSPIHPAHHKRDRRQIFLPEPEQPSRLQDPVLVSCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08514-1; Sequence=Displayed; Name=2; IsoId=P08514-2; Sequence=VSP_002737; Name=3; Synonyms=tr-alpha-IIb; IsoId=P08514-3; Sequence=VSP_002736
Alternative Sequence
910..1039; SCDSAPCTVVQCDLQEMARGQRAMVTVLAFLWLPSLYQRPLDQFVLQSHAWFNVSSLPYAVPPLSLPRGEAQVWTQLLRALEERAIPIWWVLVGVLGGLLLLTILVLAMWKVGFFKRNRPPLEEDDEEGE -> VSRLSGLWPGLPGTHGAEGMGGGRGVRVCCGPLWATLGPWEHFK (in isoform 3); 948..981; Missing (in isoform 2)
3D Structural Models
Turn
166..169; 189..193; 349..351; 413..416; 542..544; 555..557; 634..637; 911..913; 991..994; 996..1001; 1035..1038
Helix
183..188; 219..222; 231..237; 259..261; 291..294; 471..473; 547..549; 586..588; 698..700; 742..744; 942..945; 1002..1015; 1028..1031
Beta Strand
36..38; 40..43; 52..58; 60..62; 64..70; 78..80; 82..88; 91..94; 107..110; 113..118; 126..131; 134..139; 143..148; 151..153; 159..165; 170..174; 202..206; 208..210; 211..216; 225..230; 268..273; 279..281; 283..288; 297..301; 307..312; 314..318; 324..327; 330..333; 336..341; 345..348; 352..355; 358..362; 366..368; 375..379; 391..398; 400..402; 404..409; 419..423; 427..430; 435..439; 450..456; 461..463; 465..470; 475..479; 484..493; 495..497; 507..509; 512..525; 534..541; 551..554; 559..567; 575..583; 592..594; 596..603; 616..619; 622..627; 643..651; 653..655; 662..670; 678..683; 688..695; 705..708; 710..713; 715..721; 728..738; 746..755; 759..761; 767..774; 779..792; 810..819; 821..823; 825..836; 842..854; 856..861; 906..909; 916..926; 931..940; 952..965; 967..969; 977..988; 1019..1027
3D Structure
Electron microscopy (12); NMR spectroscopy (13); X-ray crystallography (50)
Domain & Motif Annotations
Repeat
35..96; FG-GAP 1; 110..173; FG-GAP 2; 187..238; FG-GAP 3; 251..305; FG-GAP 4; 306..371; FG-GAP 5; 373..432; FG-GAP 6; 435..496; FG-GAP 7
Motif
1022..1026; GFFKR motif
Protein Families
Integrin alpha chain family
Sequence Similarities
Belongs to the integrin alpha chain family.
Clinical Relevance7
Disease Involvement (3)
Cancer-related genesDisease variantFDA approved drug targets
Drug Targets
FDA approved drug targets
Drugs (12)
Interaction Protein
ENSG00000259207
Interaction Count
1
Interaction Dataset
intact_biogrid
Supporting Publications9
| PMID | Title | Abstract |
|---|---|---|
| 15790784 | ICAM-1 on exosomes from mature dendritic cells is critical for efficient naive T-cell priming. | Functional analysis using DC-derived exosomes from knock-out mice showed that MHC class II and ICAM-1 are required for mature exosomes to prime naive T cells, whereas B7.2 and MFG-E8 are dispensable. Immature dendritic cells (DCs) secrete exosomes, which transfer functional major histocompatibility complex (MHC)-peptide complexes to other DCs. Proteomic and biochemical analyses revealed that mature exosomes are enriched in MHC class II, B7.2, intercellular adhesion molecule 1 (ICAM-1), and bear little milk-fat globule-epidermal growth factor-factor VIII (MFG-E8) as compared with immature exosomes. |
| 20529672 | A membranous form of ICAM-1 on exosomes efficiently blocks leukocyte adhesion to activated endothelial cells. | In this report, we initially observed that human cancer cells shed mICAM-1(+)-exosomes but were devoid of vascular cell adhesion molecule-1 and E-selectin. Taken together with previous findings, our results indicate that mICAM-1 on exosomes exhibits potent immune modulatory activity. We demonstrate that mICAM-1 on exosomes retained its topology similar to that of cell surface ICAM-1, and could bind to leukocytes. While intercellular adhesion molecule-1 (ICAM-1) is a transmembrane protein, two types of extracellular ICAM-1 have been detected in cell culture supernatants as well as in the serum: a soluble form of ICAM-1 (sICAM-1) and a membranous form of ICAM-1 (mICAM-1) associated with exosomes. |
| 21336773 | Exosome-loaded dendritic cells elicit tumor-specific CD8+ cytotoxic T cells in patients with glioma. | Exosomes had antigen-presenting molecules (MHC-I, HSP70), tumor antigen (MAGE-1) and adherent molecule (ICAM-1). |
| 21819704 | Antileukaemia immunity: effect of exosomes against NB4 acute promyelocytic leukaemia cells. | NB4-derived exosomes expressed the proteins retinoic acid receptor α and interstitial cell adhesion molecule 1 and contained heat shock protein 70, as demonstrated by transmission electron microscopy and Western blotting. |
| 36386163 | Circulating galectin-3 promotes tumor-endothelium-adhesion by upregulating ICAM-1 in endothelium-derived extracellular vesicles. | No abstract available |
| 37646133 | ICAM-1-decorated extracellular vesicles loaded with miR-146a and Glut1 drive immunomodulation and hinder tumor progression in a murine model of breast cancer. | Engineered extracellular vesicles (EVs) decorated with ICAM-1 ligands and loaded with miR-146a and |
| 38103755 | Engineered extracellular vesicles expressing ICAM-1: A promising targeted delivery system for T cell modifications. | No abstract available |
| 38257772 | CSF Extracellular Vesicle Aβ42 and Tau/Aβ42 Ratio Are Associated with Cognitive Impairment in Older People with HIV. | Given the role of extracellular vesicles (EVs) in age-related neurological disorders, we investigated soluble and EV-associated Aβ42, total Tau, NFL, GFAP, ICAM-1, VCAM-1, and CRP in relation to cognitive impairment in PWH. |
| 38767348 | Ventilator-induced Lung Injury Promotes Inflammation within the Pleural Cavity. | Resident pleural macrophages demonstrated enhanced activation after injurious ventilation, including upregulated ICAM-1 and IL-1β expression, and the release of extracellular vesicles. |