Protein detail

CD14

Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]

Entry name
CD14
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
37
Transmembrane count
Protein classification
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
Basic Information
Protein Names
Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Protein Class (6)
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
Protein Function (5)
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Entrez Gene Symbol
Gene Description
CD14 molecule
Chromosome
5
Position
140631728-140633700
Supporting publications (n)
37
EVMP confidence score
0.88
Fluorescence & Localization
CD14 fluorescence
Tissue SpecificplacentaCell SpecificAdipocytesSingle-Nuclei Brain SpecificfibroblastSecretome LocationSecreted to extracellular matrixSecretome FunctionCell adhesion
Function & Pathway
Protein Function (5)
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence33

Ligand-Receptor Signaling (32)

32 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
cell_surface_ligandcell_surface_ligandOmniPathYesYesYes
cell_adhesioncell_adhesionCellinkerYesYesYesYes
adhesionadhesionOmniPathYesYesYesYes
cell_adhesioncell_adhesionOmniPathYesYesYesYes
transmembranetransmembraneGO_IntercellYesYes
transmembranetransmembraneOmniPathYesYes
plasma_membraneplasma_membraneUniProt_locationYesYes
plasma_membraneplasma_membraneCellinkerYesYes
plasma_membraneplasma_membraneOmniPathYesYes
plasma_membrane_peripheralplasma_membrane_peripheralCSPAYesYes
Page 2 of 4PreviousNext

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyWestern blottingMORPH22789410432089743
Sequence, Structure & Domains

Sequences

Length
375
Mass
40,076
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

3D Structural Models

3D Structure
X-ray crystallography (1)

Domain & Motif Annotations

Repeat
54..82; LRR 1; 83..118; LRR 2; 119..144; LRR 3; 145..172; LRR 4; 173..196; LRR 5; 197..224; LRR 6; 225..251; LRR 7; 252..278; LRR 8; 279..299; LRR 9; 300..321; LRR 10; 322..349; LRR 11
Domain (CC)
The C-terminal leucine-rich repeat (LRR) region is required for responses to smooth LPS.
Region
290..375; Required for response to bacterial lipopolysaccharide (LPS)
Clinical Relevance
Supporting Publications37
PMIDTitleRelated sentences
11150547Analysis of antigen presenting cell derived exosomes, based on immuno-magnetic isolation and flow cytometry.Again CD59 was expressed suggesting a possible role for APC exosomes in complement regulation. These exosomes also expressed the B cell marker CD20, and the complement inhibitory protein CD59.
26820481Extracellular Vesicle Proteins Associated with Systemic Vascular Events Correlate with Heart Failure: An Observational Study in a Dyspnoea Cohort.Extracellular vesicle levels of CD14, SerpinG1 and SerpinF2 are associated with the occurrence of heart failure in subjects suspected for acute heart failure, suggesting common underlying pathophysiological mechanisms for heart failure and vascular events. Extracellular vesicle protein levels of SerpinG1, SerpinF2, CystatinC and CD14 were measured in an observational study of 404 subjects presenting with dysponea at the emergency department (4B-cohort). Furthermore, extracellular vesicleCD14- and SerpinF2-levels were significantly higher in heart failure patients with preserved ejection fraction than in those with reduced ejection fraction. SerpinF2, SerpinG1, CystatinC and CD14 are involved in inflammatory processes and plasma extracellular vesicle (EV) -levels of these proteins have been reported to be associated with systemic vascular events. Therefore, we studied the association between plasma extracellular vesicle SerpinF2-, SerpinG1-, CystatinC and CD14-levels and the occurrence of acute heart failure in patients.
27211553HIV-Nef and ADAM17-Containing Plasma Extracellular Vesicles Induce and Correlate with Immune Pathogenesis in Chronic HIV Infection.No related sentences available
27537259Modulation of Immune Responses by Extracellular Vesicles From Retinal Pigment Epithelium.Extracellular vesicles were isolated from ARPE-19 cultures stimulated or not with the inflammatory cytokines IL-1β, IFN-γ, and TNF-α.
28469765Melatonin treatment enhances therapeutic effects of exosomes against acute liver ischemia-reperfusion injury.In vitro studies showed suppression of inflammation (MIF, MMP-9, IL-1β, TNF-α, COX-2) and oxidative stress (NOX-1, NOX-2, oxidized protein)/apoptosis (cleaved caspase 3 and PARP) by exosome and exosome/melatonin treatment, respectively (all
29632728Glioblastoma stem cell-derived exosomes induce M2 macrophages and PD-L1 expression on human monocytes.Glioblastoma stem cell-derived exosomes induce M2 macrophages and PD-L1 expression on human monocytes. Western blot analysis revealed that upregulation of PD-L1 in GSC exosome-treated monocytes and GBM-patient-infiltrating CD14
29740045Exosome markers associated with immune activation and oxidative stress in HIV patients on antiretroviral therapy.Untargeted proteomics detected markers of exosomes (CD9, CD63, CD81), immune activation (CD14, CRP, HLA-A, HLA-B), oxidative stress (CAT, PRDX1, PRDX2, TXN), and Notch4 in plasma exosomes.
29981499Snail-overexpressing Cancer Cells Promote M2-Like Polarization of Tumor-Associated Macrophages by Delivering MiR-21-Abundant Exosomes.The miR-21-containing exosomes were engulfed by CD14 Copyright \xc2\xa9 2018 The Authors.
30621731Multiple myeloma-derived exosomes are enriched of amphiregulin (AREG) and activate the epidermal growth factor pathway in the bone microenvironment leading to osteoclastogenesis.Multiple myeloma-derived exosomes are enriched of amphiregulin (AREG) and activate the epidermal growth factor pathway in the bone microenvironment leading to osteoclastogenesis. Since exosomes-derived epidermal growth factor receptor ligands (EGFR) are involved in tumor-associated osteolysis, we hypothesize that the EGFR ligand amphiregulin (AREG) can be delivered by MM-derived exosomes and participate in MM-induced osteoclastogenesis. The murine cell line RAW264.7 and primary human CD14 We found that AREG was specifically enriched in exosomes from MM samples and that exosomes-derived AREG led to the activation of EGFR in pre-OC, as showed by the increase of mRNA expression of its downstream SNAIL in both RAW264.7 and CD14 In conclusion, our data indicate that AREG is packed into MM-derived exosomes and implicated in OC differentiation through an indirect mechanism mediated by OBs.
31199456Circulating Exosomes Activate Dendritic Cells and Induce Unbalanced CD4+ T Cell Differentiation in Hashimoto Thyroiditis.After DCs were stimulated by HT exosomes, significant elevations were observed in MyD88, TRIF, and p-P65 expression; median fluorescence intensity of CD40 and CD83; and IL-6 production. TPO, HSP60, and MHC-II expression was higher in HT exosomes than in HC exosomes. The expression of thyroperoxidase (TPO), thyroglobulin, high mobility group box 1 (HMGB1), heat shock protein 60 (HSP60), major histocompatibility complex class II (MHC-II), and intercellular adhesion molecule 1 (ICAM1) in exosomes was determined by Western blotting.
Page 1 of 4Next