Protein detail
CD14
Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Entry name CD14 | UniProt ID | EVMP confidence score 0.63 |
Supporting publications (n) 37 | Transmembrane count | Protein classification Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information10
Protein Names
Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Protein Class (6)
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
Protein Function (5)
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Ensembl
Entrez Gene Symbol
Gene Description
CD14 molecule
Chromosome
5
Position
140631728-140633700
Supporting publications (n)
37
EVMP confidence score
0.63
Fluorescence & Localization6
Tissue SpecificplacentaCell SpecificAdipocytesSingle-Nuclei Brain SpecificfibroblastSecretome LocationSecreted to extracellular matrixSecretome FunctionCell adhesion
Function & Pathway7
Protein Function (5)
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Cellular Component (10)
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0010008 endosome membrane
- GO:0030667 secretory granule membrane
- GO:0045121 membrane raft
- GO:0046696 lipopolysaccharide receptor complex
- GO:0070062 extracellular exosome
Molecular Function (6)
Biological Process (3)
KEGG (15)
- hsa04010 MAPK signaling pathway
- KEGG:hsa04064 NF-kappa B signaling pathway
- KEGG:hsa04145 Phagosome
- KEGG:hsa04620 Toll-like receptor signaling pathway
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04936 Alcoholic liver disease
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05132 Salmonella infection
- KEGG:hsa05133 Pertussis
- KEGG:hsa05134 Legionellosis
Page 1 of 2
Reactome (28)
- R-hsa-936964 activation of irf3 irf7 mediated by tbk1 ikk ikbke
- R-hsa-1280218 adaptive immune system
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-109581 apoptosis
- R-hsa-140534 caspase activation via death receptors in the presence of ligand
- R-hsa-5357769 caspase activation via extrinsic apoptotic signalling pathway
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9839923 dengue virus infection
- R-hsa-5260271 diseases of immune system
Page 1 of 3
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence33
Ligand-Receptor Signaling (32)
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface_ligand | cell_surface_ligand | OmniPath | Yes | No | Yes | No | Yes |
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | No | Yes |
| adhesion | adhesion | OmniPath | Yes | Yes | Yes | No | Yes |
| cell_adhesion | cell_adhesion | OmniPath | Yes | Yes | Yes | No | Yes |
| transmembrane | transmembrane | GO_Intercell | No | No | Yes | No | Yes |
| transmembrane | transmembrane | OmniPath | No | No | Yes | No | Yes |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | Yes | No | Yes |
| plasma_membrane | plasma_membrane | Cellinker | No | No | Yes | No | Yes |
| plasma_membrane | plasma_membrane | OmniPath | No | No | Yes | No | Yes |
| plasma_membrane_peripheral | plasma_membrane_peripheral | CSPA | No | No | Yes | No | Yes |
Sequence, Structure & Domains7
Sequences
Length
375
Mass
40,076
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Repeat
54..82; LRR 1; 83..118; LRR 2; 119..144; LRR 3; 145..172; LRR 4; 173..196; LRR 5; 197..224; LRR 6; 225..251; LRR 7; 252..278; LRR 8; 279..299; LRR 9; 300..321; LRR 10; 322..349; LRR 11
Domain (CC)
The C-terminal leucine-rich repeat (LRR) region is required for responses to smooth LPS.
Region
290..375; Required for response to bacterial lipopolysaccharide (LPS)
Clinical Relevance5
Disease Involvement
Cancer-related genes
Biomarker
Phase 2
Drugs (12)
Supporting Publications37
| PMID | Title | Abstract |
|---|---|---|
| 36982991 | Extracellular Vesicles of COVID-19 Patients Reflect Inflammation, Thrombogenicity, and Disease Severity. | Severe patients' EVs displayed higher percentages of small EVs (<150 nm) with increased expression of exosome marker CD63. |
| 37438583 | Exosomal PPARγ derived from macrophages suppresses LPS-induced peritonitis by negative regulation of CD14/TLR4 axis. | Using co-culture models and mouse peritonitis model, we showed that exosomes from Raw264.7 cells overexpressing PPARγ inhibited LPS-induced inflammation in co-cultured human PMCs and in mice through downregulating CD14 and TLR4, two key regulators of the salmonella infection pathway. |
| 37568802 | Plasma Exosome Proteins ILK1 and CD14 Correlated with Organ-Specific Metastasis in Advanced Gastric Cancer Patients. | No abstract available |
| 37600336 | CD44‑hyaluronan axis plays a role in the interactions between colon cancer‑derived extracellular vesicles and human monocytes. | No abstract available |
| 38084936 | Comparative characterization of microRNA-71 of Echinococcus granulosus exosomes. | These egr-miR-71-containing exosomes were easily internalized and then induced the dysregulation of cytokines (IL-10 and TNF-α), nitric oxide (NO) and key components (CD14 and IRF5) in the LPS/TLR4 pathway in the coincubated sheep PBMCs. |
| 38902710 | Exosomes multiplex profiling, a promising strategy for early diagnosis of laryngeal cancer. | Circulating exosomes were collected from serum collected from 30 LCa patients and 20 healthy volunteers by the use of antibody affinity method exploiting CD63 specific surface marker. |
| 39166055 | Dental pulp stem cells regenerate neural tissue in degenerative disorders and stroke rehabilitation: A scope systematic review. | DPSC-derived exosomes suppressed the expression of IL-6, IL-1β, TNF-α, and TGF, key mediators of nerve tissue inflammation. |
Page 4 of 4Previous