Protein detail

CD14

Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]

Entry name
CD14
UniProt ID
EVMP confidence score
0.63
Supporting publications (n)
37
Transmembrane count
Protein classification
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information10
Protein Names
Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Protein Class (6)
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
Protein Function (5)
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Entrez Gene Symbol
Gene Description
CD14 molecule
Chromosome
5
Position
140631728-140633700
Supporting publications (n)
37
EVMP confidence score
0.63
Fluorescence & Localization6
CD14 fluorescence
Tissue SpecificplacentaCell SpecificAdipocytesSingle-Nuclei Brain SpecificfibroblastSecretome LocationSecreted to extracellular matrixSecretome FunctionCell adhesion
Function & Pathway7
Protein Function (5)
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence33

Ligand-Receptor Signaling (32)

32 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
plasma_membrane_peripheralplasma_membrane_peripheralOmniPathNoNoYesNoYes
secretedsecretedUniProt_keywordNoNoYesNoYes
secretedsecretedUniProt_locationNoNoYesNoYes
secretedsecretedHPA_secretomeNoNoYesNoYes
secretedsecretedOmniPathNoNoYesNoYes
cell_surfacecell_surfaceSurfaceomeNoNoYesNoYes
cell_surfacecell_surfaceconnectomeDB2020NoNoYesNoYes
cell_surfacecell_surfaceOmniPathNoNoYesNoYes
receptorreceptorscConnectNoYesYesNoYes
receptorreceptorCellCellInteractionsNoYesYesNoYes
Page 3 of 4PreviousNext

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyWestern blottingMORPH22789410432089743
Sequence, Structure & Domains7

Sequences

Length
375
Mass
40,076
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

3D Structural Models

3D Structure
X-ray crystallography (1)

Domain & Motif Annotations

Repeat
54..82; LRR 1; 83..118; LRR 2; 119..144; LRR 3; 145..172; LRR 4; 173..196; LRR 5; 197..224; LRR 6; 225..251; LRR 7; 252..278; LRR 8; 279..299; LRR 9; 300..321; LRR 10; 322..349; LRR 11
Domain (CC)
The C-terminal leucine-rich repeat (LRR) region is required for responses to smooth LPS.
Region
290..375; Required for response to bacterial lipopolysaccharide (LPS)
Clinical Relevance5
Supporting Publications37
PMIDTitleAbstract
32166281Circulating Gasdermin-D in Critically Ill Patients.Our findings also suggest that active gasdermin-D in septic patients is encapsulated in exosomes derived from activated monocytes.
32343772Intestinal CD14+ Macrophages Protect CD4+ T Cells From Activation-induced Cell Death via Exosomal Membrane TNF in Crohn's Disease.Mechanistically, CD14+ Mφ released exosomes express membrane tumour necrosis factor [TNF] which engages TNFR2 on CD4+ T cells and triggers NF-κB signalling, thereby causing AICD resistance.
32648717Extracellular vesicle Cystatin C and CD14 are associated with both renal dysfunction and heart failure.No abstract available
32855524miR-21a in exosomes from Lewis lung carcinoma cells accelerates tumor growth through targeting PDCD4 to enhance expansion of myeloid-derived suppressor cells.In addition, our data showed that exosomes derived from human lung cancer cell lines expressing miR-21a, also induced expansion of MDSCs in human CD14
33135636CD14 release induced by P2X7 receptor restricts inflammation and increases survival during sepsis.Here, we show for first time that P2X7 receptor induces the release of CD14 in extracellular vesicles, resulting in a net reduction in macrophage plasma membrane CD14 that functionally affects LPS, but not monophosphoryl lipid A, pro-inflammatory cytokine production.
33252112Differentiation of Monocytes into Phenotypically Distinct Macrophages After Treatment with Human Cord Blood Stem Cell (CB-SC)-Derived Exosomes.By co-culturing Dio-labeled CB-SC-derived exosomes with human peripheral blood mononuclear cells (PBMC), we found that CB-SC-derived exosomes were predominantly taken up by human CD14-positive monocytes, leading to the differentiation of monocytes into type 2 macrophages (M2), with spindle-like morphology and expression of M2-associated surface molecular markers.
33330567Relationship Between T-Cell Exosomes and Cellular Subsets in SLE According to Type I IFN-Signaling.No abstract available
33669497Resistance Training Diminishes the Expression of Exosome CD63 Protein without Modification of Plasma miR-146a-5p and cfDNA in the Elderly.The levels of exosome markers (Flot-1, CD9, and CD81) as well as exosome-carried proteins (CD14 and VDAC1) remained unchanged, whereas an attenuated CD63 response was found in the trained group compared to the controls. The levels of plasma miR-146a-5p, cfDNA, and exosome markers (CD9, CD14, CD63, CD81, Flotillin [Flot]-1, and VDAC1) were measured prior to and following training. These findings might partially support the anti-inflammatory effect of resistance training in the elderly as evidenced by the diminishment of exosome CD63 protein expression, without modification of plasma miR-146a-5p and cfDNA.
34006621Exosomes From Subjects With Multiple Sclerosis Express EBV-Derived Proteins and Activate Monocyte-Derived Macrophages.After data normalization, we observed that incubation with EBV(+) exosomes induced CXCL10 and CCL2 secretion by MDMs.
34071980Exosome-Based Molecular Transfer Activity of Macrophage-Like Cells Involves Viability of Oral Carcinoma Cells: Size Exclusion Chromatography and Concentration Filter Method.Using the SEC-CF method, the following five EV types were fractionated from the culture supernatant of macrophage-like cells: (i) rare large EVs (500-3000 nm) reminiscent of apoptosomes, (ii) EVs (100-500 nm) reminiscent of microvesicles (or microparticles), (iii) EVs (80-300 nm) containing CD9-positive large exosomes (EXO-L), (iv) EVs (20-200 nm) containing unidentified vesicles/particles, and (v) EVs (10-70 nm) containing CD63/HSP90-positive small exosomes (EXO-S) and particles.
Page 2 of 4PreviousNext