Protein detail
CD14
Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Protein symbol CD14 | UniProt ID | EVMP score 0.63 |
Frequency 37 | Transmembrane count | Protein classification Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters |
Basic Information
Protein Names
Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Protein Class
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
Protein Function
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Ensembl
Entrez Gene Symbol
Gene Description
CD14 molecule
Chromosome
5
Position
140631728-140633700
Frequency
37
EVMP Score
0.63
Fluorescence & Localization
Tissue SpecificplacentaCell SpecificAdipocytesSingle-Nuclei Brain SpecificfibroblastSecretome LocationSecreted to extracellular matrixSecretome FunctionCell adhesion
Function & Pathway
Protein Function
- CD markers
- Cancer-related genes:Candidate cancer biomarkers
- Predicted secreted proteins
- Transporters:Accessory Factors Involved in Transport
- Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Cellular Component
- GO:0005576 extracellular region
- GO:0005615 extracellular space
- GO:0005794 Golgi apparatus
- GO:0005886 plasma membrane
- GO:0009897 external side of plasma membrane
- GO:0010008 endosome membrane
- GO:0030667 secretory granule membrane
- GO:0045121 membrane raft
- GO:0046696 lipopolysaccharide receptor complex
- GO:0070062 extracellular exosome
Molecular Function
Biological Process
KEGG
- hsa04010 MAPK signaling pathway
- KEGG:hsa04064 NF-kappa B signaling pathway
- KEGG:hsa04145 Phagosome
- KEGG:hsa04620 Toll-like receptor signaling pathway
- KEGG:hsa04640 Hematopoietic cell lineage
- KEGG:hsa04936 Alcoholic liver disease
- KEGG:hsa05131 Shigellosis
- KEGG:hsa05132 Salmonella infection
- KEGG:hsa05133 Pertussis
- KEGG:hsa05134 Legionellosis
- KEGG:hsa05146 Amoebiasis
- KEGG:hsa05152 Tuberculosis
- KEGG:hsa05202 Transcriptional misregulation in cancer
- KEGG:hsa05221 Acute myeloid leukemia
- KEGG:hsa05417 Lipid and atherosclerosis
Reactome
- R-hsa-936964 activation of irf3 irf7 mediated by tbk1 ikk ikbke
- R-hsa-1280218 adaptive immune system
- R-hsa-1236975 antigen processing cross presentation
- R-hsa-109581 apoptosis
- R-hsa-140534 caspase activation via death receptors in the presence of ligand
- R-hsa-5357769 caspase activation via extrinsic apoptotic signalling pathway
- R-hsa-983169 class i mhc mediated antigen processing presentation
- R-hsa-9918485 dengue virus attachment and entry
- R-hsa-9839923 dengue virus infection
- R-hsa-5260271 diseases of immune system
- R-hsa-937041 ikk complex recruitment mediated by rip1
- R-hsa-5663205 infectious disease
- R-hsa-168249 innate immune system
- R-hsa-5603041 irak4 deficiency tlr2 4
- R-hsa-166166 myd88 independent tlr4 cascade
- R-hsa-6798695 neutrophil degranulation
- R-hsa-5357801 programmed cell death
- R-hsa-9824878 regulation of tbk1 ikk ikbke mediated activation of irf3 irf7
- R-hsa-5686938 regulation of tlr by endogenous ligand
- R-hsa-9820952 respiratory syncytial virus infection pathway
- R-hsa-9820960 respiratory syncytial virus rsv attachment and entry
- R-hsa-9833110 rsv host interactions
- R-hsa-168138 toll like receptor 9 tlr9 cascade
- R-hsa-168898 toll like receptor cascades
- R-hsa-168179 toll like receptor tlr1 tlr2 cascade
- R-hsa-937072 traf6 mediated induction of tak1 complex within tlr4 complex
- R-hsa-2562578 trif mediated programmed cell death
- R-hsa-9824446 viral infection pathways
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
32 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| scavenger | receptor | HGNC | No | Yes | Yes | No | Yes |
| receptor | receptor | HGNC | No | Yes | Yes | No | Yes |
Page 4 of 4Previous
Regulatory Interaction Network
0 records.
Protein Complex Composition
0 records.
Sequence, Structure & Domains
Sequences
Length
375
Mass
40,076
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA
3D Structural Models
3D Structure
X-ray crystallography (1)
Domain & Motif Annotations
Repeat
54..82; LRR 1; 83..118; LRR 2; 119..144; LRR 3; 145..172; LRR 4; 173..196; LRR 5; 197..224; LRR 6; 225..251; LRR 7; 252..278; LRR 8; 279..299; LRR 9; 300..321; LRR 10; 322..349; LRR 11
Domain (CC)
The C-terminal leucine-rich repeat (LRR) region is required for responses to smooth LPS.
Region
290..375; Required for response to bacterial lipopolysaccharide (LPS)
Clinical Relevance
Disease Involvement
Cancer-related genes
Biomarker
Phase 2
Drugs