Protein detail

CD14

Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]

Entry name
CD14
UniProt ID
EVMP confidence score
0.63
Supporting publications (n)
37
Transmembrane count
Protein classification
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information10
Protein Names
Monocyte differentiation antigen CD14 (My23 antigen) (Myeloid cell-specific leucine-rich glycoprotein) (CD antigen CD14) [Cleaved into: Monocyte differentiation antigen CD14, urinary form; Monocyte differentiation antigen CD14, membrane-bound form]
Protein Class (6)
Cancer-related genesCD markersHuman disease related genesPlasma proteinsPredicted secreted proteinsTransporters
Protein Function (5)
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Entrez Gene Symbol
Gene Description
CD14 molecule
Chromosome
5
Position
140631728-140633700
Supporting publications (n)
37
EVMP confidence score
0.63
Fluorescence & Localization6
CD14 fluorescence
Tissue SpecificplacentaCell SpecificAdipocytesSingle-Nuclei Brain SpecificfibroblastSecretome LocationSecreted to extracellular matrixSecretome FunctionCell adhesion
Function & Pathway7
Protein Function (5)
  • CD markers
  • Cancer-related genes:Candidate cancer biomarkers
  • Predicted secreted proteins
  • Transporters:Accessory Factors Involved in Transport
  • Human disease related genes:Immune system diseases:Allergies and autoimmune diseases
Mediation Categories (4)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediation
Relations & Evidence33

Ligand-Receptor Signaling (32)

32 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
receptorreceptorGO_IntercellNoYesYesNoYes
receptorreceptorOmniPathNoYesYesNoYes
extracellularextracellularDGIdbNoNoYesNoYes
extracellularextracellularLOCATENoNoYesNoYes
extracellularextracellularOmniPathNoNoYesNoYes
intracellularintracellularComPPINoNoYesNoYes
intracellularintracellularGO_IntercellNoNoYesNoYes
intracellularintracellularUniProt_locationNoNoYesNoYes
intracellularintracellularOmniPathNoNoYesNoYes
cell_surface_ligandcell_surface_ligandconnectomeDB2020YesNoYesNoYes
Page 1 of 4Next

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Differential UltracentrifugationSize Exclusion ChromatographyWestern blottingMORPH22789410432089743
Sequence, Structure & Domains7

Sequences

Length
375
Mass
40,076
Sequence
MERASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA

3D Structural Models

3D Structure
X-ray crystallography (1)

Domain & Motif Annotations

Repeat
54..82; LRR 1; 83..118; LRR 2; 119..144; LRR 3; 145..172; LRR 4; 173..196; LRR 5; 197..224; LRR 6; 225..251; LRR 7; 252..278; LRR 8; 279..299; LRR 9; 300..321; LRR 10; 322..349; LRR 11
Domain (CC)
The C-terminal leucine-rich repeat (LRR) region is required for responses to smooth LPS.
Region
290..375; Required for response to bacterial lipopolysaccharide (LPS)
Clinical Relevance5
Supporting Publications37
PMIDTitleAbstract
34407878Exosomes from primed MSCs can educate monocytes as a cellular therapy for hematopoietic acute radiation syndrome.LPS priming of MSCs led to the production of exosomes with increased expression of CD9, CD29, CD44, CD146, and MCSP.
34439311The Fatty Acid and Protein Profiles of Circulating CD81-Positive Small Extracellular Vesicles Are Associated with Disease Stage in Melanoma Patients.No abstract available
34440851Ewing Sarcoma-Derived Extracellular Vesicles Impair Dendritic Cell Maturation and Function.Here, EVs were purified from EwS and fibroblast cell lines and exhibited characteristics of small EVs, including size (100-170 nm) and exosome markers CD63, CD81, and TSG101.
35234046CD14-positive extracellular vesicles in bronchoalveolar lavage fluid as a new biomarker of acute respiratory distress syndrome.No abstract available
35294531Identification of CD14 and lipopolysaccharide-binding protein as novel biomarkers for sarcoidosis using proteomics of serum extracellular vesicles.No abstract available
35846887CD14 and CD26 from serum exosomes are associated with type 2 diabetes, exosomal Cystatin C and CD14 are associated with metabolic syndrome and atherogenic index of plasma.Finally, the increased levels of CD14 and Cystatin C in exosomes are related to MetS. The aim of this study was to evaluate the association of cystatin C, CD26, and CD14 proteins in serum exosomes from patients with Type 2 Diabetes (T2D), metabolic syndrome (MetS), and atherogenic index of plasma (AIP). We observed a significant correlation of increased glucose with elevated levels of Cystatin C, and an effect of T2D on the levels of CD26 (β = 45.8 pg/µg; T2D may contribute to the increase of CD14 protein contained in exosomes, as well as to the predisposition of atherogenic events development due to its relationship with the increase in serum triglyceride concentrations and the AIP score.
36334903Plasma Extracellular Vesicle Serpin G1 and CD14 Levels are Associated with Major Adverse Cardiovascular Events and Major Adverse Limb Events in Patients Undergoing Femoral Endarterectomy.No abstract available
36462328Tumor-derived exosomes elicit cancer-associated fibroblasts shaping inflammatory tumor microenvironment in head and neck squamous cell carcinoma.Moreover, T cells or CD14-positive cells were co-cultured with culture supernatants from exosome-educated fibroblasts. The effects of the exosomes on fibroblasts were examined by proliferation and migration assays, and exosome-educated fibroblasts were analyzed for the expression of eight genes (IL1B, IL6, CXCL8, TGFB1, ACTA2, FAP, CD274, and PDCD1LG2) by RT-qPCR.
36526691COVID-19 plasma exosomes promote proinflammatory immune responses in peripheral blood mononuclear cells.Here, we report that plasma exosomes of COVID-19 patients contain SARS-CoV-2 double stranded RNA (dsRNA) and stimulate robust production of interleukin-6 (IL-6), IL-8, tumor necrosis factor-α (TNF-α), and other inflammatory cytokines and chemokines by human peripheral mononuclear cells.
36531939miR-1260b inhibits periodontal bone loss by targeting ATF6β mediated regulation of ER stress.Our previous work demonstrated that exosomes from tumor necrosis factor (TNF)-α-primed human gingiva-derived MSCs (GMSCs) could be a therapeutic tool against periodontitis, and that TNFα-inducible exosomal miR-1260b is essential for the inhibition of alveolar bone loss.
Page 3 of 4PreviousNext