Protein detail
CD63
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Entry name CD63 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 741 | Transmembrane count 4 | Protein classification CD markersPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Protein Class (4)
CD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ME491MLA1TSPAN30
Gene Description
CD63 molecule
Chromosome
12
Position
55725323-55729707
Supporting publications (n)
741
EVMP confidence score
0.88
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (15)
- GO:0005615 extracellular space
- GO:0005654 nucleoplasm
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0009986 cell surface
- GO:0010008 endosome membrane
- GO:0031088 platelet dense granule membrane
- GO:0031902 late endosome membrane
- GO:0031904 endosome lumen
- GO:0032585 multivesicular body membrane
Page 1 of 2
Molecular Function
Biological Process (3)
KEGG (3)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence49
Ligand-Receptor Signaling (47)
47 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_adhesion | receptor | ICELLNET | Yes | Yes | Yes | ||
| receptor | receptor | OmniPath | Yes | Yes | Yes | ||
| extracellular | extracellular | HPMR | Yes | Yes | |||
| extracellular | extracellular | OmniPath | Yes | Yes | |||
| intracellular | intracellular | LOCATE | Yes | Yes | |||
| intracellular | intracellular | ComPPI | Yes | Yes | |||
| intracellular | intracellular | GO_Intercell | Yes | Yes | |||
| intracellular | intracellular | UniProt_location | Yes | Yes | |||
| intracellular | intracellular | OmniPath | Yes | Yes | |||
| cell_adhesion | cell_adhesion | Cellinker | Yes | Yes | Yes | Yes |
Protein Complex Composition (1)
1 record.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster25 | ARL6IP5ATP5F1AATP5F1DATP5MEATP5MFATP5MGATP5MGLATP5PBATP5POCD63ELOVL1ELOVL7PRAF2RTN1RTN2RTN3RTN4TSPAN6 | A1L3X0O43657O60831O75298O75915O75964O95197P08962P24539P25705P30049P48047P56134P56385Q16799Q7Z4Y8Q9BW60Q9NQC3 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | Compleat | Compleat:HC3353 | 22036573 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
238
Mass
25,637
Sequence
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996
Alternative Sequence
1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)
Domain & Motif Annotations
Motif
234..238; Lysosomal targeting motif
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Interaction Protein (2)
ENSG00000102265ENSG00000150093
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications741
| PMID | Title | Related sentences |
|---|---|---|
| 27492928 | Nanomechanical sandwich assay for multiple cancer biomarkers in breast cancer cell-derived exosomes. | Excellent selectivity however, was achieved when targeting the cell-surface proteoglycan, Glypican-1 at extraordinary limits (\xe2\x88\xbc200 exosomes per mL, \xe2\x88\xbc0.1 pg mL(-1)). Exosomes from breast cancer were selectively identified by detecting over-expressed membrane-proteins CD24, CD63, and EGFR. |
| 27536982 | Human vaginal fluid contains exosomes that have an inhibitory effect on an early step of the HIV-1 life cycle. | Vaginal fluid contains exosomes expressing CD9, CD63, and CD81 exosomal markers. |
| 27542209 | Boar seminal plasma exosomes maintain sperm function by infiltrating into the sperm membrane. | Boar seminal plasma exosomes had typical nano-structure morphology as measured by scanning electron microscopy (SEM) and molecular markers such as AWN, CD9 and CD63 by western blot analysis. |
| 27559612 | Y-box protein 1 is required to sort microRNAs into exosomes in cells and in a cell-free reaction. | To study the mechanisms of RNA packaging into exosomes, we devised a purification scheme based on the membrane marker CD63 to isolate a single exosome species secreted from HEK293T cells. Using immunoisolated CD63-containing exosomes we identified a set of miRNAs that are highly enriched with respect to their cellular levels. |
| 27592404 | Hepatoprotective effect of exosomes from human-induced pluripotent stem cell-derived mesenchymal stromal cells against hepatic ischemia-reperfusion injury in rats. | Inflammatory markers, such as tumor necrosis factor (TNF)-α, interleukin (IL)-6 and high mobility group box 1 (HMGB1), were significantly reduced after administration of hiPSC-MSCs-Exo, which suggests that the exosomes have a role in suppressing the inflammatory response. |
| 27657169 | Tetherin is an exosomal tether. | Here we show that inactivating the vacuolar ATPase in HeLa cells causes a dramatic increase in the production of exosomes, which display endocytosed tracers, cholesterol, and CD63. |
| 27697217 | Placental exosomes and pre-eclampsia: Maternal circulating levels in normal pregnancies and, early and late onset pre-eclamptic pregnancies. | Total exosomes were quantified using nanoparticle tracking analysis and immuno-reactive exosomalCD63 quantification. |
| 27716356 | Exosomes derived from HCC cells induce sorafenib resistance in hepatocellular carcinoma both in vivo and in vitro. | Exosomes derived from HCC cells were of the expected size and expressed the exosomal markers CD9 and CD63. |
| 27722146 | Quantitative Analysis of Exosomes From Murine Lung Cancer Cells by Flow Cytometry. | We detected an increase in CD63-specific exosomes in LA-4 lung cancer cells. |
| 27765945 | Different populations of Wnt-containing vesicles are individually released from polarized epithelial cells. | Basolaterally secreted Wnt3a were co-fractionated with a typical exosomal protein TSG101 in fractions having typical exosome densities. In contrast, most of apically secreted Wnt3a, as well as Wnt11, were co-fractionated with CD63 and Hsp70, which are also common to the most exosomes, but recovered in higher density fractions. The lipidation of Wnt3a was required for its basolateral secretion in exosomes but was dispensable for the apical one. |