Protein detail

CD63

CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)

Entry name CD63	UniProt ID P08962	EVMP confidence score 0.63
Supporting publications (n) 765	Transmembrane count 4	Protein classification CD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (4)

CD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical

Transmembrane Count

Ensembl

ENSG00000135404

Entrez Gene Symbol

CD63

Gene Synonym (3)

ME491MLA1TSPAN30

Gene Description

CD63 molecule

Chromosome

Position

55725323-55729707

Supporting publications (n)

765

EVMP confidence score

0.63

Fluorescence & Localization4

Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway7

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (15)

Page 1 of 2

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG (3)

Reactome (5)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence49

Ligand-Receptor Signaling (47)

47 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	OmniPath	No	Yes	Yes	Yes	No
extracellular	extracellular	HPMR	No	No	Yes	Yes	No
extracellular	extracellular	OmniPath	No	No	Yes	Yes	No
intracellular	intracellular	LOCATE	No	No	Yes	Yes	No
intracellular	intracellular	ComPPI	No	No	Yes	Yes	No
intracellular	intracellular	GO_Intercell	No	No	Yes	Yes	No
intracellular	intracellular	UniProt_location	No	No	Yes	Yes	No
intracellular	intracellular	OmniPath	No	No	Yes	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	Yes	Yes	No

Page 2 of 5Previous Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster25	ARL6IP5 ATP5F1A ATP5F1D ATP5ME ATP5MF ATP5MG ATP5MGL ATP5PB ATP5PO CD63 ELOVL1 ELOVL7 PRAF2 RTN1 RTN2 RTN3 RTN4 TSPAN6	A1L3X0 O43657 O60831 O75298 O75915 O75964 O95197 P08962 P24539 P25705 P30049 P48047 P56134 P56385 Q16799 Q7Z4Y8 Q9BW60 Q9NQC3	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC3353	22036573

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry [LTQ-FT Ultra]Mass spectrometry	0

Sequence, Structure & Domains8

Sequences

Length

238

Mass

25,637

Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996

Alternative Sequence

1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)

Domain & Motif Annotations

Motif

234..238; Lysosomal targeting motif

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance5

Drugs (2)

NONSTEROIDAL ANTIINFLAMMATORY DRUG COMPOUND 6B [PMID: 22749870]

Antibody (3)

HPA010088 CAB026356 HPA073506

Interaction Protein (2)

ENSG00000102265ENSG00000150093

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications741

PMID	Title	Abstract
35639245	Label-Free Analysis of Exosomes with Hairpin Structure-Mediated Multiple Signal Amplification Strategy.	In this method, a designed SMB (Streptavidin magnetic bead)-capture probe is utilized to specially recognize CD63 protein on the surface of exosome.
35655952	Single Extracellular Vesicle Analysis Using Flow Cytometry for Neurological Disorder Biomarkers.	In this study, using flow cytometry to analyze individual neuronal EVs, we show that our plasma EVs isolated by size exclusion chromatography are mainly CD63-positive exosomes of endosomal origin.
35657460	Exosomes Secreted from circZFHX3-modified Mesenchymal Stem Cells Repaired Spinal Cord Injury Through mir-16-5p/IGF-1 in Mice.	No abstract available
35689956	Downregulated miR-129-5p expression inhibits rat pulmonary fibrosis by upregulating STAT1 gene expression in macrophages.	Compared with the mimic NC-exo group, the miR-129-5p-exo group had significantly increased proliferation of fibroblasts, decreased expression of STAT1, and significantly increased expression of COL1A2, COL3A1, fibronectin and α-SMA, and M2 macrophage-secreted exosomes could carry miR-129-5p to fibroblasts.
35695270	Neuroendocrine, inflammatory, and extracellular vesicle responses during the Navy Special Warfare Screener Selection Course.	EVs stained with markers associated with exosomes (CD63), microvesicles (VAMP3), and apoptotic bodies (THSD1) were characterized using imaging flow cytometry and vesicle flow cytometry.
35698293	Mast cell-derived exosomal miR-181a-5p modulated trophoblast cell viability, migration, and invasion via YY1/MMP-9 axis.	Mast cell exosomes were successfully isolated, containing high expressions of CD63 and HSP70 and low expression of Calnexin and could be transported to the cytoplasm of trophoblast cells.
35700522	Isolation of circulating exosomes and identification of exosomal PD-L1 for predicting immunotherapy response.	Herein, we used iodixanol density gradient centrifugation for the isolation and purification of exosomes and label-free detection of exosomal PD-L1 using a biochip based on surface plasmon resonance (SPR-Exo
35708514	Biological characteristics of adipose-derived stem cells from patients with progressive hemifacial atrophy: An in vivo study.	NTA particle size, electron microscopy (TEM), and WB for CD63 and TSG10 were used to detect the exosomes.
35716063	Ascorbate peroxidase-mediated in situ labelling of proteins in secreted exosomes.	In this methodology, a variant of the engineered ascorbate peroxidase APEX, fused to an exosome cargo protein such as CD63, is expressed specifically in exosome-generating vesicles in live cells or in secreted exosomes in the conditioned medium, to induce biotinylation of the proteins in the vicinity of the APEX variant for a short period of time. Mass spectrometry analysis of the proteins biotinylated by this approach in exosomes secreted by kidney proximal tubule-derived cells reveals that oxidative stress can cause ribosomal proteins to accumulate in an exosome subpopulation that contains the CD63-fused APEX variant.
35728610	Analysis of Thrombin-Activated Platelet-Derived Exosome (T-aPDE) Potential for Dental Pulp Regeneration: In-Vitro Study.	This study analyzed the potential of various concentrations of the thrombin-activated platelet-derived exosome (T-aPDE) to regenerate the dental pulp by performing an The hDPSCs were collected from nine third molar teeth of nine healthy donors and were isolated and cultured using the explant method.

Page 60 of 75Previous Next