Protein detail

CD63

CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)

Entry name
CD63
UniProt ID
EVMP confidence score
0.88
Supporting publications (n)
741
Transmembrane count
4
Protein classification
CD markersPlasma proteinsPredicted membrane proteinsTransporters
Basic Information
Protein Names
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Protein Class (4)
CD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (2)
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Transmembrane
12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (3)
ME491MLA1TSPAN30
Gene Description
CD63 molecule
Chromosome
12
Position
55725323-55729707
Supporting publications (n)
741
EVMP confidence score
0.88
Fluorescence & Localization
CD63 fluorescence
Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Relations & Evidence49

Ligand-Receptor Signaling (47)

47 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
cell_adhesionreceptorICELLNETYesYesYes
receptorreceptorOmniPathYesYesYes
extracellularextracellularHPMRYesYes
extracellularextracellularOmniPathYesYes
intracellularintracellularLOCATEYesYes
intracellularintracellularComPPIYesYes
intracellularintracellularGO_IntercellYesYes
intracellularintracellularUniProt_locationYesYes
intracellularintracellularOmniPathYesYes
cell_adhesioncell_adhesionCellinkerYesYesYesYes
Page 2 of 5PreviousNext

Protein Complex Composition (1)

1 record.

Component NameComponent Gene SymbolsComponent UniProt IDStoichiometryDatabaseDatabase IDsReferences
HT_DM_Cluster25ARL6IP5ATP5F1AATP5F1DATP5MEATP5MFATP5MGATP5MGLATP5PBATP5POCD63ELOVL1ELOVL7PRAF2RTN1RTN2RTN3RTN4TSPAN6A1L3X0O43657O60831O75298O75915O75964O95197P08962P24539P25705P30049P48047P56134P56385Q16799Q7Z4Y8Q9BW60Q9NQC31:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1CompleatCompleat:HC335322036573

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Mass spectrometry [LTQ-FT Ultra]Mass spectrometry0
Sequence, Structure & Domains

Sequences

Length
238
Mass
25,637
Sequence
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996
Alternative Sequence
1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)

Domain & Motif Annotations

Motif
234..238; Lysosomal targeting motif
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Interaction Protein (2)
ENSG00000102265ENSG00000150093
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications741
PMIDTitleRelated sentences
38342761Exosome MiR-21-5p Upregulated by HIF-1α Induces Adipose Stem Cell Differentiation to Promote Ectopic Bone Formation.First, we identified exosomes extracted from L6 cells using TEM observation of the structure and western blotting detection of the surface marker CD63.
38354024Investigation of exosomal tetraspanin profile in sepsis patients as a promising diagnostic biomarker.Exosomes were isolated and characterize via TEM and CD63 ELISA kits.
38400284Negative Charge-Carrying Glycans Attached to Exosomes as Novel Liquid Biopsy Marker.In addition, surface plasmon resonance (SPR) is used to study three different receptors on the exosomal surface (CD63, CD81 and prostate-specific membrane antigen-PMSA), implementing monoclonal antibodies and identifying the type of glycans present on the surface of exosomes using lectins (glycan-recognising proteins).
38409426Mass Spectrometry-Based Characterization of Protein Aggregates in Tissues and Biofluids.The western blotting analyses of the isolated pellet showed the positivity for CD89 and CD63, consolidated markers of exosomes, confirming the presence of exosomes within the pellet but not in the supernatant in human plasma.
38430799Exosomes from porcine serum as endogenous additive maintain function of boar sperm during liquid preservation at 17 °C in vitro.Scanning electron microscopy (SEM) confirmed that serum-derived exosomes from both castrated boars (cbsExos) and sows (ssExos) exhibited typical nanostructural morphology and expressed CD63, CD9, and Alix, as shown by Western blotting.
38439112Docosahexaenoic acid (DHA) impairs hypoxia-induced cellular and exosomal overexpression of immune-checkpoints and immunomodulatory molecules in different subtypes of breast cancer cells.MDA-MB-231 and BT-474 cells were treated with 100 \xc2\xb5M DHA under hypoxic and normoxic conditions for 24\xc2\xa0h. Exosomes were isolated by ultracentrifuge and confirmed by electron microscope and anti-CD9, -CD63, -CD81 immunoblotting. Total RNA from cells and exosomes were extracted and expression of CD39, CD73, CD47, CD80, PD-L1, B7-H3, B7-H4 genes and their related miRs were evaluated by quantitative Real-time PCR.
38472166Serum exosomal miR-3662 down-regulates the expression of RBMS3 to promote malignant progression and gemcitabine resistance of breast cancer cells.The expression of marker proteins (TSG101, CD63, and CD81) in patients' serum exosomes was evaluated through western blot, and exosomes were observed using transmission electron microscopy.
38567379Exosomes Derived from Human Palatal Mesenchymal Cells Mediate Intercellular Communication During Palatal Fusion by Promoting Oral Epithelial Cell Migration.The expression of CD63 was also observed in the acellular basement membrane between the palatal epithelium and the mesenchyme in vivo, and HEPM-EXO could be internalized by HIOEC in vitro, suggesting that exosomes are potent to diffuse through the cellular tissue boundary to mediate palatal cell-cell communication. The expression of exosome marker CD63 and CD81 in palatal cells during palatogenesis was detected by immunofluorescence staining.
38590572Airway basal cell‑derived exosomes suppress epithelial‑mesenchymal transition of lung cells by inhibiting the expression of ANO1.Exosomes were round-like and positively expressed CD63 and tumor susceptibility gene 101 protein. Treatment with exosomes inhibited the EMT of lung cells activated by TGF-\xce\xb21.
38591903[Exosomes' role in intercellular interactions in different variants of lung injury in fatal cases of COVID-19].We selected 32 cases with morphological signs of various types of lung lesions for immunohistochemical reaction (IHC) with antibodies against tetraspanin proteins (CD63, CD81), which are involved in the assembly of exosomes, as well as with antibodies against viral proteins: nucleocapsid and spike protein.
Page 71 of 75PreviousNext