Protein detail

CD63

CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)

Entry name CD63	UniProt ID P08962	EVMP confidence score 0.63
Supporting publications (n) 765	Transmembrane count 4	Protein classification CD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (4)

CD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical

Transmembrane Count

Ensembl

ENSG00000135404

Entrez Gene Symbol

CD63

Gene Synonym (3)

ME491MLA1TSPAN30

Gene Description

CD63 molecule

Chromosome

Position

55725323-55729707

Supporting publications (n)

765

EVMP confidence score

0.63

Fluorescence & Localization4

Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway7

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (15)

Page 1 of 2

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG (3)

Reactome (5)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence49

Ligand-Receptor Signaling (47)

47 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
cell_adhesion	receptor	ICELLNET	No	Yes	Yes	Yes	No
receptor	receptor	OmniPath	No	Yes	Yes	Yes	No
extracellular	extracellular	HPMR	No	No	Yes	Yes	No
extracellular	extracellular	OmniPath	No	No	Yes	Yes	No
intracellular	intracellular	LOCATE	No	No	Yes	Yes	No
intracellular	intracellular	ComPPI	No	No	Yes	Yes	No
intracellular	intracellular	GO_Intercell	No	No	Yes	Yes	No
intracellular	intracellular	UniProt_location	No	No	Yes	Yes	No
intracellular	intracellular	OmniPath	No	No	Yes	Yes	No
cell_adhesion	cell_adhesion	Cellinker	Yes	Yes	Yes	Yes	No

Page 2 of 5Previous Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster25	ARL6IP5 ATP5F1A ATP5F1D ATP5ME ATP5MF ATP5MG ATP5MGL ATP5PB ATP5PO CD63 ELOVL1 ELOVL7 PRAF2 RTN1 RTN2 RTN3 RTN4 TSPAN6	A1L3X0 O43657 O60831 O75298 O75915 O75964 O95197 P08962 P24539 P25705 P30049 P48047 P56134 P56385 Q16799 Q7Z4Y8 Q9BW60 Q9NQC3	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC3353	22036573

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry [LTQ-FT Ultra]Mass spectrometry	0

Sequence, Structure & Domains8

Sequences

Length

238

Mass

25,637

Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996

Alternative Sequence

1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)

Domain & Motif Annotations

Motif

234..238; Lysosomal targeting motif

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance5

Drugs (2)

NONSTEROIDAL ANTIINFLAMMATORY DRUG COMPOUND 6B [PMID: 22749870]

Antibody (3)

HPA010088 CAB026356 HPA073506

Interaction Protein (2)

ENSG00000102265ENSG00000150093

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications741

PMID	Title	Abstract
38624007	Label-Free Multiplex Profiling of Exosomal Proteins with a Deep Learning-Driven 3D Surround-Enhancing SERS Platform for Early Cancer Diagnosis.	Combining this 3D se-SERS with a deep learning model, we successfully quantitatively profiled seven proteins including CD63, CD81, CD9, CD151, CD171, TSPAN8, and PD-L1 on the surface of plasma exosomes from patients, which can predict the occurrence and advancement of lung cancer.
38627767	Exosomes biogenesis was increased in metformin-treated human ovary cancer cells; possibly to mediate resistance.	After treatment with metformin, exosomes were isolated from cells and quantified by acetylcholinesterase (AChE) assay, Dynamic Light Scattering (DLS), and their markers. In vitro scratch assay showed that the cell migration rate of metformin-treated cells was decreased (P < 0.05), whereas AChE activity of exosomes from metformin-treated cells was increased (P < 0.05).
38630028	Storage of plasma-derived exosomes: evaluation of anticoagulant use and preserving temperatures.	Exosome features including morphological characteristics, pariticles size diameter, and surface protein profiles (TSG101, CD63, CD81, CD9, CALNEXIN) were assessed by transmission electron microscopy, Nanoparticle Tracking Analysis, and Western Blotting, respectively.
38684330	Bone marrow mesenchymal stem cell-derived extracellular vesicles promote corneal epithelial repair and suppress apoptosis via modulation of Caspase-3 in vitro.	The isolated extracellular vesicles were spherical, < 150 nm in diameter, and characterized as CD9 © 2024 The Authors.
38718108	Endocytosis blocks the vesicular secretion of exosome marker proteins.	Furthermore, we show that syntenin, a previously described exosome biogenesis factor, drives the vesicular secretion of CD63 by blocking CD63 endocytosis and that other endocytosis inhibitors also induce the plasma membrane accumulation and vesicular secretion of CD63. To better understand how cells release these vesicles, we examined the biogenesis of the most highly enriched human exosome marker proteins, the exosomal tetraspanins CD81, CD9, and CD63.
38754193	CRISPR/Cas12a and aptamer-chemiluminescence based analysis for the relative abundance determination of tumor-related protein positive exosomes for breast cancer diagnosis.	The total concentration of exosomes was determined through captured CD63 using a CRISPR/Cas12a-based method with the LoD of 8.97 × 10 Copyright © 2024 Elsevier B.V. All rights reserved.
38783745	Detection of micro-plasma-induced exosomes secretion in a fibroblast-melanoma co-culture model.	In this study, label-free surface-enhanced Raman spectroscopy (SERS) method with size-matched selectivity was used to detect membrane proteins in exosomes released from a stimulated environment of fibroblasts (L929) co-cultured with melanoma cells (B16-F10). Secondly, the particle size of secreted exosomes isolated from the culture medium of L929, B16-F10, and co-cultured cells with different micro-plasma treatment time did not increase significantly under single-cell conditions at short treatment time but might be changed under co-culture condition or longer treatment time. Third, for SERS signals related to membrane protein biomarkers, exosome markers CD9, CD63, and CD81 can be assigned to significant Raman shifts in the range of 943-1030 and 1304-1561 cm-1, while the characteristics SERS peaks of L929 and B16-F10 cells are most likely located at 1394/1404, 1271 and 1592 cm-1 respectively.
38785322	Label-Free Measurement of CD63 Positive Extracellular Vesicles Using Terahertz Chemical Microscopy.	In this study, extracellular vesicles of the human nonsmall cell lung cancer cell line H1299 and the unlabeled antiCD63 antibody were imaged using a new label-free terahertz chemical microscopy (TCM) technique to detect changes in the terahertz wave amplitude.
38785998	Fusion with ARRDC1 or CD63: A Strategy to Enhance p53 Loading into Extracellular Vesicles for Tumor Suppression.	No abstract available
38830977	An anion exchange membrane sensor detects EGFR and its activity state in plasma CD63 extracellular vesicles from patients with glioblastoma.	We present a quantitative sandwich immunoassay for CD63 Extracellular Vesicles (EVs) and a constituent surface cargo, EGFR and its activity state, that provides a sensitive, selective, fluorophore-free and rapid alternative to current EV-based diagnostic methods.

Page 72 of 75Previous Next