Protein detail

CD63

CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)

Entry name CD63	UniProt ID P08962	EVMP confidence score 0.63
Supporting publications (n) 765	Transmembrane count 4	Protein classification CD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (4)

CD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical

Transmembrane Count

Ensembl

ENSG00000135404

Entrez Gene Symbol

CD63

Gene Synonym (3)

ME491MLA1TSPAN30

Gene Description

CD63 molecule

Chromosome

Position

55725323-55729707

Supporting publications (n)

765

EVMP confidence score

0.63

Fluorescence & Localization4

Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway7

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (15)

Page 1 of 2

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG (3)

Reactome (5)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence49

Ligand-Receptor Signaling (47)

47 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
adhesion	adhesion	OmniPath	Yes	Yes	Yes	Yes	No
cell_adhesion	cell_adhesion	OmniPath	Yes	Yes	Yes	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	Yes	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	Yes	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	Yes	Yes	No
transmembrane	transmembrane	TopDB	No	No	Yes	Yes	No
transmembrane	transmembrane	LOCATE	No	No	Yes	Yes	No
transmembrane	transmembrane	Ramilowski_location	No	No	Yes	Yes	No
transmembrane	transmembrane	OmniPath	No	No	Yes	Yes	No
plasma_membrane	plasma_membrane	UniProt_location	No	No	Yes	Yes	No

Page 3 of 5Previous Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster25	ARL6IP5 ATP5F1A ATP5F1D ATP5ME ATP5MF ATP5MG ATP5MGL ATP5PB ATP5PO CD63 ELOVL1 ELOVL7 PRAF2 RTN1 RTN2 RTN3 RTN4 TSPAN6	A1L3X0 O43657 O60831 O75298 O75915 O75964 O95197 P08962 P24539 P25705 P30049 P48047 P56134 P56385 Q16799 Q7Z4Y8 Q9BW60 Q9NQC3	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC3353	22036573

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry [LTQ-FT Ultra]Mass spectrometry	0

Sequence, Structure & Domains8

Sequences

Length

238

Mass

25,637

Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996

Alternative Sequence

1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)

Domain & Motif Annotations

Motif

234..238; Lysosomal targeting motif

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance5

Drugs (2)

NONSTEROIDAL ANTIINFLAMMATORY DRUG COMPOUND 6B [PMID: 22749870]

Antibody (3)

HPA010088 CAB026356 HPA073506

Interaction Protein (2)

ENSG00000102265ENSG00000150093

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications741

PMID	Title	Abstract
28114422	A Comparative Study of Serum Exosome Isolation Using Differential Ultracentrifugation and Three Commercial Reagents.	The isolated exosomes were characterized based upon size, quantity, zeta potential, CD63 and CD9 protein expression, and exosomal RNA (exRNA) quality and quantity using several complementary methods: nanoparticle tracking analysis (NTA) with ZetaView, western blot, transmission electron microscopy (TEM), the Agilent Bioanalyzer system, and droplet digital PCR (ddPCR).
28116765	Urinary exosomes as a novel biomarker for evaluation of α-lipoic acid's protective effect in early diabetic nephropathy.	In summary, we emphasize short-term α-LA could protect the kidney in the early DN against general oxidative stress, particularly the urinary CD63-positive exosome could be a potential sensitive and therapeutic indicator. Notably, the CD63 expressing of exosomes in urine was found higher in the normoalbuminuria patients compared with those in microalbuminuria, parallelly only declined markedly after α-LA administration in normoalbuminuria patients.
28129550	ATP binding cassette A1 (ABCA1) mediates microparticle formation during high-density lipoprotein (HDL) biogenesis.	MPs do not contain apoA-I, but contain flotilin-2, a marker of plasma membrane, and CD63, an exosome marker.
28161063	Influence of maternal BMI on the exosomal profile during gestation and their role on maternal systemic inflammation.	Total exosomes and specific placenta-derived exosomes were determined by Nanoparticle Tracking Analysis (NanoSight™) using quantum dots coupled with CD63 or PLAP antibodies.
28167415	A visible and colorimetric aptasensor based on DNA-capped single-walled carbon nanotubes for detection of exosomes.	Aptamers, specific to exosomes transmembrane protein CD63, are absorbed onto the surface of s-SWCNTs and improve the minic peroxidase activity of s-SWCNTs, which can efficiently catalyze H Copyright © 2017 Elsevier B.V. All rights reserved.
28251957	[Contamination of exosome preparations, isolated from biological fluids].	All exosome preparations (over 200) contained exosomes, which were identified by immuno-electron microscopy using antibodies to tetraspanins CD63 or CD9.
28346015	The role of exosomes derived from cerebrospinal fluid of spinal cord injury in neuron proliferation in vitro.	The results demonstrated these exosomes all expressed CD9, CD63, CD81, Alix and Tsg101; however, only exosomes derived from cerebrospinal fluid of SCI could promote proliferation of neuron via ERK signaling pathway, and decrease cell apoptosis.
28350871	Oxygen tension regulates the miRNA profile and bioactivity of exosomes released from extravillous trophoblast cells - Liquid biopsies for monitoring complications of pregnancy.	8% and 1% oxygen) on exosome release was quantified using nanocrystals (Qdot®) coupled to CD63 by fluorescence NTA.
28360912	Exosomes Isolated from Ascites of T-Cell Lymphoma-Bearing Mice Expressing Surface CD24 and HSP-90 Induce a Tumor-Specific Immune Response.	No abstract available
28485529	Exosomes mediate interepithelial transfer of functional P-glycoprotein in chronic rhinosinusitis with nasal polyps.	P-gp content of purified mucus exosomes was characterized by transmission electron microscopy and enzyme-linked immunosorbent assay. P-gp was significantly enriched in CRSwNP exosomes relative to control (median 198.5; interquartile range 123.6-270.5 vs. 74.4; 41.3-95.0 pcg P-gp/10 Here we demonstrate the presence and P-gp enrichment of mucus-derived exosomes, or rhinosomes, in CRSwNP. The aims of this study were 1) to determine whether CRSwNP mucus exosomes are enriched with P-gp, and 2) whether exosomal P-gp can be functionally transferred to autologous epithelial cells as a putative mechanism for the proinflammatory overexpression of P-gp in CRSwNP.

Page 16 of 75Previous Next