Protein detail

CD63

CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)

Entry name
CD63
UniProt ID
EVMP confidence score
0.63
Supporting publications (n)
765
Transmembrane count
4
Protein classification
CD markersPlasma proteinsPredicted membrane proteinsTransporters
EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40
Basic Information13
Protein Names
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Protein Class (4)
CD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (2)
  • CD markers
  • Transporters:Accessory Factors Involved in Transport
Transmembrane
12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical
Transmembrane Count
4
Entrez Gene Symbol
Gene Synonym (3)
ME491MLA1TSPAN30
Gene Description
CD63 molecule
Chromosome
12
Position
55725323-55729707
Supporting publications (n)
765
EVMP confidence score
0.63
Fluorescence & Localization4
CD63 fluorescence
Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway7
Relations & Evidence49

Ligand-Receptor Signaling (47)

47 records.

CategoryParentDatabaseTransmitterReceiverSecretedPlasma Membrane (Transmembrane)Plasma Membrane (Peripheral)
adhesionadhesionOmniPathYesYesYesYesNo
cell_adhesioncell_adhesionOmniPathYesYesYesYesNo
transmembranetransmembraneUniProt_locationNoNoYesYesNo
transmembranetransmembraneUniProt_topologyNoNoYesYesNo
transmembranetransmembraneUniProt_keywordNoNoYesYesNo
transmembranetransmembraneTopDBNoNoYesYesNo
transmembranetransmembraneLOCATENoNoYesYesNo
transmembranetransmembraneRamilowski_locationNoNoYesYesNo
transmembranetransmembraneOmniPathNoNoYesYesNo
plasma_membraneplasma_membraneUniProt_locationNoNoYesYesNo
Page 3 of 5PreviousNext

Isolation & Detection Technology (1)

1 record.

EV Isolation MethodDetection MethodNumber of ReferencesReferences
Mass spectrometry [LTQ-FT Ultra]Mass spectrometry0
Sequence, Structure & Domains8

Sequences

Length
238
Mass
25,637
Sequence
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996
Alternative Sequence
1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)

Domain & Motif Annotations

Motif
234..238; Lysosomal targeting motif
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance5
Interaction Protein (2)
ENSG00000102265ENSG00000150093
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications741
PMIDTitleAbstract
34321877Antibacterial Effect of Honey-Derived Exosomes Containing Antimicrobial Peptides Against Oral Streptococci.Recently, our group found exosome-like extracellular vesicles (EVs) in Molecular characterization of HEc-EVs identified for the first time important conserved exosome markers such as CD63 and syntenin, and the antibacterial molecules MRJP1, defensin-1 and jellein-3 were found as intravesicular cargo.
34335040Release and Actions of Inflammatory Exosomes in Pulmonary Emphysema: Potential Therapeutic Target of Acupuncture.However, EA of non-specific BL23 together with ST36 acupoint had no effects on NLRP3 inflammasome activation, exosome release and associated lung pathology during emphysema. IL-1β, a prototype NLRP3 inflammasome activating product, was also found to have increased in the lung during emphysema, which was colocalized with CD63 (an exosome marker), an indicative of inflammatory exosome formation. NLRP3 inflammasome activation in concert with increased release of exosomes containing IL-1β or other inflammasome products contributes to the development of lung inflammation and injury during PPE-induced emphysema and that EA of lung-specific acupoints attenuates inflammasome activation and exosome release, thereby reducing inflammatory response in the lung of mice with emphysema. The present study tested the hypothesis that exosome-mediated release of NLRP3 inflammasome products instigates the inflammatory response in the lung during emphysema, a type of chronic obstructive pulmonary disease (COPD) and that electroacupuncture (EA) may attenuate emphysema by inhibition of NLRP3 inflammasome activation and consequent inflammation.
34366842The Depolarization-Evoked, Ca2+-Dependent Release of Exosomes From Mouse Cortical Nerve Endings: New Insights Into Synaptic Transmission.The structural and biochemical analysis unveiled that supernatants contain vesicles that have the size and the shape of exosomes, which were immunopositive for the exosomal markers TSG101, flotillin-1, CD63, and CD9.
34383347Exosomal tumor necrosis factor-α from hepatocellular cancer cells (Huh-7) promote osteoclast differentiation.Huh-7 exosomes were characterized for size and exosome marker expressions (CD63, Alix).
34384449Isolation and identification of exosomes from feline plasma, urine and adipose-derived mesenchymal stem cells.Detected particles showed the normal size (30-100 nm) and morphology described for exosomes, as well as presence of the transmembrane protein (TSG101, CD9, CD63, and CD81) known as exosomal marker.
34407412CD63-mediated cloaking of VEGF in small extracellular vesicles contributes to anti-VEGF therapy resistance.As described here, we demonstrate that cancer-derived small extracellular vesicles package increasing quantities of VEGF and other factors in response to anti-VEGF therapy. The packaging process of VEGF into small extracellular vesicles (EVs) is mediated by the tetraspanin CD63.
34423573Primary breast cancer biomarkers based on glycosylation and extracellular vesicles detected from human serum.Our aim was to develop an approach to detect the aberrant glycosylation of mucins and extracellular vesicle-associated glycoproteins from human sera using fluorescent nanoparticles, and preliminarily evaluate this approach for the differential diagnosis of breast cancer. The glycosylation of circulating extracellular vesicle-associated glycoproteins, and mucins may offer targets for detection methods and have been only explored in a limited capacity.
34434533Androgens alter the heterogeneity of small extracellular vesicles and the small RNA cargo in prostate cancer.In this study, we report that plasma-derived circulating vesicles consisting of CD9 and double-positive for CD9 and Prostate Specific Membrane Antigen (PSMA) are increased in patients with advanced metastatic prostate cancer, whereas double positives for CD9 and CD63 small extracellular vesicles (S-EVs) are significantly higher in patients with localised prostate cancer.
34440851Ewing Sarcoma-Derived Extracellular Vesicles Impair Dendritic Cell Maturation and Function.Here, EVs were purified from EwS and fibroblast cell lines and exhibited characteristics of small EVs, including size (100-170 nm) and exosome markers CD63, CD81, and TSG101.
34442609The Specific Gravity-Free Method for the Isolation of Circulating Tumor KRAS Mutant DNA and Exosome in Colorectal Cancer.We present a dual isolation system including a polydopamine (PDA)-silica-coated alginate bead for circulating tumor DNA (ctDNA) capture and an anti-CD63 immobilized bead for exosome capture.
Page 50 of 75PreviousNext