Protein detail

CD63

CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)

Entry name CD63	UniProt ID P08962	EVMP confidence score 0.63
Supporting publications (n) 765	Transmembrane count 4	Protein classification CD markersPlasma proteinsPredicted membrane proteinsTransporters

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Protein Class (4)

CD markersPlasma proteinsPredicted membrane proteinsTransporters

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Transmembrane

12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical

Transmembrane Count

Ensembl

ENSG00000135404

Entrez Gene Symbol

CD63

Gene Synonym (3)

ME491MLA1TSPAN30

Gene Description

CD63 molecule

Chromosome

Position

55725323-55729707

Supporting publications (n)

765

EVMP confidence score

0.63

Fluorescence & Localization4

Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell

Function & Pathway7

Protein Function (2)

CD markers
Transporters:Accessory Factors Involved in Transport

Cellular Component (15)

Page 1 of 2

Molecular Function

GO:0005515 protein binding

Biological Process (3)

KEGG (3)

Reactome (5)

Mediation Categories (3)

Adhesion and uptake mediationFusion and delivery mediationImmune mediation

Relations & Evidence49

Ligand-Receptor Signaling (47)

47 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
plasma_membrane	plasma_membrane	Cellinker	No	No	Yes	Yes	No
plasma_membrane	plasma_membrane	OmniPath	No	No	Yes	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	CSPA	No	No	Yes	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	HPMR	No	No	Yes	Yes	No
plasma_membrane_transmembrane	plasma_membrane_transmembrane	OmniPath	No	No	Yes	Yes	No
secreted	secreted	UniProt_keyword	No	No	Yes	Yes	No
secreted	secreted	UniProt_location	No	No	Yes	Yes	No
secreted	secreted	OmniPath	No	No	Yes	Yes	No
cell_surface	cell_surface	Surfaceome	No	No	Yes	Yes	No
cell_surface	cell_surface	connectomeDB2020	No	No	Yes	Yes	No

Page 4 of 5Previous Next

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster25	ARL6IP5 ATP5F1A ATP5F1D ATP5ME ATP5MF ATP5MG ATP5MGL ATP5PB ATP5PO CD63 ELOVL1 ELOVL7 PRAF2 RTN1 RTN2 RTN3 RTN4 TSPAN6	A1L3X0 O43657 O60831 O75298 O75915 O75964 O95197 P08962 P24539 P25705 P30049 P48047 P56134 P56385 Q16799 Q7Z4Y8 Q9BW60 Q9NQC3	1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1	Compleat	Compleat:HC3353	22036573

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
	Mass spectrometry [LTQ-FT Ultra]Mass spectrometry	0

Sequence, Structure & Domains8

Sequences

Length

238

Mass

25,637

Sequence

MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM

Alternative Products

Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996

Alternative Sequence

1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)

Domain & Motif Annotations

Motif

234..238; Lysosomal targeting motif

Protein Families

Tetraspanin (TM4SF) family

Sequence Similarities

Belongs to the tetraspanin (TM4SF) family.

Clinical Relevance5

Drugs (2)

NONSTEROIDAL ANTIINFLAMMATORY DRUG COMPOUND 6B [PMID: 22749870]

Antibody (3)

HPA010088 CAB026356 HPA073506

Interaction Protein (2)

ENSG00000102265ENSG00000150093

Interaction Count

Interaction Dataset

intact_biogrid

Supporting Publications741

PMID	Title	Abstract
30678441	Protease Cargo in Circulating Exosomes of Breast Cancer and Ovarian Cancer Patients.	At CD9-positive exosomes from BCPs plasma and MCF-7 was reveal a high expression of ADAM-10 and low expression is from BBDPs plasma and ovarian tumor patients plasma/ ascites samples. Conclusion: Breast and ovarian cancer development is connected with functioning of immune proteasome forms in plasma and ascites exosomes, while increased ADAM10 expression at CD9-positive exosome was associated with breast cancer and at CD24-positive subpopulation – with ovarian cancer. Exosomes from ascites OCP had high expression of ADAM-10 in the CD24-positive subpopulation. The aim of this study was to evaluate the levels of tetraspanine-associated (ADAM-10) and tetraspanine-nonassociated proteases (20S proteasomes) in exosomes from culture medium, plasma exosomes of patients with breast tumors and plasma and ascites of ovarian tumor patients. The expression levels of 20S proteasome and ADAM-10 in exosomes were determined using flow cytometry and western blot analysis, correspondingly.
30680751	Nanoscale flow cytometry to distinguish subpopulations of prostate extracellular vesicles in patient plasma.	Plasmas from prostate cancer (PCa) patient plasmas representing benign prostatic hyperplasia (BPH), low grade prostate cancer (Gleason Score 3 + 3) and high grade prostate cancer (Gleason Score ≥4 + 4) were analyzed for various exosome markers (CD9, CD63, CD81) and a prostate specific tissue marker (prostate specific membrane antigen/PSMA).
30716336	Leukemia-derived exosomes induced IL-8 production in bone marrow stromal cells to protect the leukemia cells against chemotherapy.	An increase in the expression of the 70 kDa heat shock proteins (HSP70) as well as lysosomal associated membrane protein 3 (CD63) was observed in the exosomes from BMSC and AML, co-cultivated in conditioned media.
30733650	Proteomic analysis of plasma exosomes to differentiate malignant from benign pulmonary nodules.	Western blot confirmed that protein expression of CD63 and CD9 could be detected in the exosome extract.
30745143	Live Tracking of Inter-organ Communication by Endogenous Exosomes In Vivo.	We identified a subpopulation of EVs with exosome features, released in a syntenin-dependent manner from the yolk syncytial layer into the blood circulation.
30768610	Ornithine decarboxylase antizyme inhibitor 2 (AZIN2) is a signature of secretory phenotype and independent predictor of adverse prognosis in colorectal cancer.	Given that AZIN2 is a regulator of vesicle transport and secretion, we overexpressed human AZIN2 cDNA in T84 CRC cells, and found strongly enhanced accumulation of CD63-positive exosomes in the culture medium.
30775228	Exosome Release Is Regulated by mTORC1.	It is found that in cells and animal models exosome release is inhibited by sustained activation of mTORC1, leading to intracellular accumulation of CD63-positive exosome precursors.
30777349	Cyclophosphamide enhances the release of tumor exosomes that elicit a specific immune response in vivo in a murine T-cell lymphoma.	These EVs express exosome marker proteins such as TSG-101, CD9, CD81, and CD63.
30820789	Pancreatic Juice Exosomal MicroRNAs as Biomarkers for Detection of Pancreatic Ductal Adenocarcinoma.	The presence of exosomes was confirmed by electron microscopy and Western blotting using anti-CD63, -CD81, and -TSG101 antibodies.
30850633	Subtyping of circulating exosome-bound amyloid β reflects brain plaque deposition.	As compared to the unbound or total circulating Aβ, the exosome-bound Aβ measurement could better reflect PET imaging of brain amyloid plaques and differentiate various clinical groups. Employing the platform, we find that prefibrillar Aβ aggregates preferentially bind with exosomes. Here, we present a dedicated analytical platform for measuring different populations of circulating amyloid β (Aβ) proteins - exosome-bound vs. unbound - directly from blood. We thus define a population of Aβ as exosome-bound (Aβ42+ CD63+) and measure its abundance directly from AD and control blood samples.

Page 26 of 75Previous Next