Protein detail
CD63
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Entry name CD63 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 741 | Transmembrane count 4 | Protein classification CD markersPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Protein Class (4)
CD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ME491MLA1TSPAN30
Gene Description
CD63 molecule
Chromosome
12
Position
55725323-55729707
Supporting publications (n)
741
EVMP confidence score
0.88
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (15)
- GO:0005615 extracellular space
- GO:0005654 nucleoplasm
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0009986 cell surface
- GO:0010008 endosome membrane
- GO:0031088 platelet dense granule membrane
- GO:0031902 late endosome membrane
- GO:0031904 endosome lumen
- GO:0032585 multivesicular body membrane
Page 1 of 2
Molecular Function
Biological Process (3)
KEGG (3)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence49
Ligand-Receptor Signaling (47)
47 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| cell_surface | cell_surface | OmniPath | Yes | Yes | |||
| receptor | receptor | talklr | Yes | Yes | Yes | ||
| receptor | receptor | Cellinker | Yes | Yes | Yes | ||
| receptor | receptor | connectomeDB2020 | Yes | Yes | Yes | ||
| receptor | receptor | iTALK | Yes | Yes | Yes | ||
| receptor | receptor | EMBRACE | Yes | Yes | Yes | ||
| transmembrane | transmembrane_predicted | Phobius | Yes | Yes |
Page 5 of 5Previous
Protein Complex Composition (1)
1 record.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster25 | ARL6IP5ATP5F1AATP5F1DATP5MEATP5MFATP5MGATP5MGLATP5PBATP5POCD63ELOVL1ELOVL7PRAF2RTN1RTN2RTN3RTN4TSPAN6 | A1L3X0O43657O60831O75298O75915O75964O95197P08962P24539P25705P30049P48047P56134P56385Q16799Q7Z4Y8Q9BW60Q9NQC3 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | Compleat | Compleat:HC3353 | 22036573 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
238
Mass
25,637
Sequence
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996
Alternative Sequence
1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)
Domain & Motif Annotations
Motif
234..238; Lysosomal targeting motif
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Interaction Protein (2)
ENSG00000102265ENSG00000150093
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications741
| PMID | Title | Related sentences |
|---|---|---|
| 33497388 | The characterization of exosomes from fibrosarcoma cell and the useful usage of Dynamic Light Scattering (DLS) for their evaluation. | Results from dot blot and western blot analysis demonstrated that GM1 ganglioside, and TSG101, HSC70 and GAPDH proteins were contained in exosomes from the WEHI-164 fibrosarcoma cell line. The existence of tetraspanins such as CD81, CD63 and CD9 was confirmed in the exosomes by ExoView analysis. |
| 33530152 | The exosome of platelet endothelial cell adhesion molecule-1 (PECAM1) protein: A potential risking star in high blood pressure patients (HBPP). | In our study, we found that the protein platelet endothelial cell adhesion molecule-1 (PECAM1) was an extracellular vesicle in the blood of high blood pressure patients (HBPP).Isolated the vesicles from the blood of HBPP and health examiners and detected its size and morphology with nanoparticle tracking analysis, then we identified its surface protein CD63, CD81, and the protein expression of PECAM1 in the exosome with western blot. |
| 33544944 | T cell-derived exosomes containing cytokines induced keratinocytes apoptosis in oral lichen planus. | OLP T cell-derived exosomes contained upregulated interleukin-7, -10, -12, -17 and downregulated interleukin-1β, -5, and interferon-γ. |
| 33558596 | Pentapartite fractionation of particles in oral fluids by differential centrifugation. | Canonical exosome markers, including CD63, CD9, CD133, and HSP70, were found in all fractions, whereas CD81 and AQP5 were enriched in the 160K fraction, with non-negligible amounts in the 2K fraction. |
| 33565399 | [Exosomes derived from human-induced pluripotent mesenchymal stem cells inhibit the pyrolysis of alveolar macrophages]. | The extracted exosomes were observed by transmission electron microscopy as round vesicles, expressing exosomal markers CD63 and CD9 showed by Western blotting, high-resolution adjustable resistance pulse showed the average diameter of the particles was 130 nm, and could be uptaken by AM. |
| 33643547 | Cross-flow microfiltration for isolation, selective capture and release of liposarcoma extracellular vesicles. | Therefore, the micro-nanofluidic device integrates the unit operations of size-based separation with CD63 antibody immunoaffinity-based capture of extracellular vesicles in the same device to evaluate EV-cargo content for liposarcoma. |
| 33649776 | Exosome-mediated radiosensitizing effect on neighboring cancer cells via increase in intracellular levels of reactive oxygen species. | In order to confirm the presence of exosomes in the human pancreatic cancer cell line MIAPaCa\xe2\x80\x912, ultracentrifugation was performed followed by transmission electron microscopy and nanoparticle tracking analysis\xc2\xa0(NanoSight) using the exosome\xe2\x80\x91specific surface markers CD9 and CD63. |
| 33669497 | Resistance Training Diminishes the Expression of Exosome CD63 Protein without Modification of Plasma miR-146a-5p and cfDNA in the Elderly. | Resistance Training Diminishes the Expression of Exosome CD63 Protein without Modification of Plasma miR-146a-5p and cfDNA in the Elderly. The levels of exosome markers (Flot-1, CD9, and CD81) as well as exosome-carried proteins (CD14 and VDAC1) remained unchanged, whereas an attenuated CD63 response was found in the trained group compared to the controls. The levels of plasma miR-146a-5p, cfDNA, and exosome markers (CD9, CD14, CD63, CD81, Flotillin [Flot]-1, and VDAC1) were measured prior to and following training. These findings might partially support the anti-inflammatory effect of resistance training in the elderly as evidenced by the diminishment of exosome CD63 protein expression, without modification of plasma miR-146a-5p and cfDNA. |
| 33673859 | TP53 drives abscopal effect by secretion of senescence-associated molecular signals in non-small cell lung cancer. | We further demonstrates that irradiation of A549 cells in vitro induces a senescence-associated secretory phenotype (SASP) producing extracellular vesicles (EVs) expressing CD63 and carrying DNA:RNA hybrids and LINE-1 retrotransposon. |
| 33717398 | Chimeric antigen-guiding extracellular vesicles eliminate antigen-specific Th2 cells in subjects with food allergy. | Purified mEVs had the molecular markers of extracellular vesicle, CD81, CD63, and CD9, cleaved Casp3 and MHC II/OVA complexes. This study aims to eliminate the Ag-specific Th2 cells with a novel nanoparticle, the mEV (modified extracellular vesicles, that carry a chimeric antigen peptide, MHC II and caspase 3) in a murine FA model. |