Protein detail
CD63
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Entry name CD63 | UniProt ID | EVMP confidence score 0.88 |
Supporting publications (n) 741 | Transmembrane count 4 | Protein classification CD markersPlasma proteinsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
CD63 antigen (Granulophysin) (Lysosomal-associated membrane protein 3) (LAMP-3) (Lysosome integral membrane protein 1) (Limp1) (Melanoma-associated antigen ME491) (OMA81H) (Ocular melanoma-associated antigen) (Tetraspanin-30) (Tspan-30) (CD antigen CD63)
Protein Class (4)
CD markersPlasma proteinsPredicted membrane proteinsTransporters
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Transmembrane
12..32; Helical; 52..72; Helical; 82..102; Helical; 204..224; Helical
Transmembrane Count
4
Ensembl
Entrez Gene Symbol
Gene Synonym (3)
ME491MLA1TSPAN30
Gene Description
CD63 molecule
Chromosome
12
Position
55725323-55729707
Supporting publications (n)
741
EVMP confidence score
0.88
Fluorescence & Localization
Tissue Specificblood vesselCell SpecificNeutrophil progenitorsSingle-Nuclei Brain Specificendothelial cell
Function & Pathway
Protein Function (2)
- CD markers
- Transporters:Accessory Factors Involved in Transport
Cellular Component (15)
- GO:0005615 extracellular space
- GO:0005654 nucleoplasm
- GO:0005765 lysosomal membrane
- GO:0005886 plasma membrane
- GO:0009986 cell surface
- GO:0010008 endosome membrane
- GO:0031088 platelet dense granule membrane
- GO:0031902 late endosome membrane
- GO:0031904 endosome lumen
- GO:0032585 multivesicular body membrane
Page 1 of 2
Molecular Function
Biological Process (3)
KEGG (3)
Reactome (5)
Mediation Categories (3)
Adhesion and uptake mediationFusion and delivery mediationImmune mediation
Relations & Evidence49
Ligand-Receptor Signaling (47)
47 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | Yes | Yes | Yes | ||
| receptor | receptor | HPMR | Yes | Yes | Yes | ||
| receptor | receptor | ICELLNET | Yes | Yes | Yes | ||
| receptor | receptor | CellTalkDB | Yes | Yes | Yes | ||
| receptor | receptor | Ramilowski2015 | Yes | Yes | Yes | ||
| receptor | receptor | LRdb | Yes | Yes | Yes | ||
| receptor | receptor | Baccin2019 | Yes | Yes | Yes | ||
| cytokine | receptor | Baccin2019 | Yes | Yes | Yes | ||
| tetraspanins | receptor | HPMR | Yes | Yes | Yes | ||
| cd63 | receptor | HPMR | Yes | Yes | Yes |
Page 1 of 5Next
Protein Complex Composition (1)
1 record.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster25 | ARL6IP5ATP5F1AATP5F1DATP5MEATP5MFATP5MGATP5MGLATP5PBATP5POCD63ELOVL1ELOVL7PRAF2RTN1RTN2RTN3RTN4TSPAN6 | A1L3X0O43657O60831O75298O75915O75964O95197P08962P24539P25705P30049P48047P56134P56385Q16799Q7Z4Y8Q9BW60Q9NQC3 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | Compleat | Compleat:HC3353 | 22036573 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Mass spectrometry [LTQ-FT Ultra]Mass spectrometry | 0 |
Sequence, Structure & Domains
Sequences
Length
238
Mass
25,637
Sequence
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Alternative Products
Event=Alternative splicing; Named isoforms=3; Name=1; IsoId=P08962-1; Sequence=Displayed; Name=2; IsoId=P08962-2; Sequence=VSP_045300; Name=3; IsoId=P08962-3; Sequence=VSP_046996
Alternative Sequence
1..82; Missing (in isoform 3); 23..45; Missing (in isoform 2)
Domain & Motif Annotations
Motif
234..238; Lysosomal targeting motif
Protein Families
Tetraspanin (TM4SF) family
Sequence Similarities
Belongs to the tetraspanin (TM4SF) family.
Clinical Relevance
Interaction Protein (2)
ENSG00000102265ENSG00000150093
Interaction Count
2
Interaction Dataset
intact_biogrid
Supporting Publications741
| PMID | Title | Related sentences |
|---|---|---|
| 35957917 | MiR-520a-5p/PPP5C regulation pattern is identified as the key to gemcitabine resistance in pancreatic cancer. | Five groups of HUVEC cells treated with exosomes were subjected to APSC-1 cells had an IC50 value of 227.1 \xce\xbcM for gemcitabine, elevated PPP5C expression, drug resistance, and enhanced HUVEC cell activity; exosomes CD9, CD63, and CD81 were significantly expressed in all groups; meanwhile, enhanced PPP5C expression not only promoted PPP5C has a prognostic role in pancreatic cancer by promoting the value-added and invasion of pancreatic cancer cells, and a targeted inhibitory relationship between miR-520-5p and PPP5C was found. |
| 35988100 | Exosomal mir-625-3p derived from hypoxic lung cancer cells facilitates metastasis by targeting SCAI. | Levels of CD63, CD 9 and CD 81 proteins were up-regulated on the membrane of exosomes secreted by hypoxic NCI-H446 cells. |
| 35988652 | A shared, stochastic pathway mediates exosome protein budding along plasma and endosome membranes. | We show that exosome cargo proteins bud from cells (i) in exosome-sized vesicles regardless of whether they are localized to plasma or endosome membranes, (ii) \xe2\x88\xbc5-fold more efficiently when localized to the plasma membrane, (iii) \xe2\x88\xbc5-fold less efficiently when targeted to the endosome membrane, (iv) by a stochastic process that leads to \xe2\x88\xbc100-fold differences in their abundance from one exosome to another, and (v) independently of small GTPase Rab27a, the ESCRT complex-associated protein Alix, or the cargo protein CD63. |
| 35995206 | Wharton Jelly Derived Mesenchymal Stem Cell's Exosomes Demonstrate Significant Antileishmanial and Wound Healing Effects in Combination with Aloe-Emodin: An in Vitro Study. | According to outcome of flow cytometic analysis, vesicles isolated from WJ-MSCs highly expressed the markers such as CD63 special for exosome profile. |
| 35999549 | ROS triggered local delivery of stealth exosomes to tumors for enhanced chemo/photodynamic therapy. | Exosomes were coated with CP05-TK-mPEG2000, in which CP05 is a peptide with high affinity to exosomalCD63 and TK could be cleaved by ROS. |
| 36055382 | Renomedullary exosomes produce antihypertensive effects in reversible two-kidney one-clip renovascular hypertensive mice. | Exosomes from 2K1C but not sham control mice exerted potent MAP-lowering and diuretic-natriuretic effects in both 2K1C and angiotensin II-infused hypertensive mice. Immunohistochemical analysis of exosome markers, CD63 and AnnexinII, showed increased staining in interstitial cells of the inner medulla of stenotic but not contralateral control kidney of clipped 2K1C mice. |
| 36060136 | Bioactivity of Exosomes Derived from Trained Natural Killer Cells versus Non-Trained One: More Functional and Antitumor Activity. | Based on flow cytometry, CD56 marker was 89.7% and 40.1% for NK cells and NK-derived exosomes, respectively. CD63 and CD9 were positive for exosomes by western blotting. Furthermore, the trained exosomes showed up-regulation in both P53 and caspase3 genes as compared with non-trained sample. |
| 36063111 | MiR-22-3p in exosomes increases the risk of heart failure after down-regulation of FURIN. | The extracted exosomes were identified by transmission electron microscopy, and Western blot was used to detect the expressions of Tsg101 and CD63. |
| 36063301 | Stem Cell Exosomes Improve Survival of Neural Stem Cells after Radiation Exposure. | All exosomes carried markers CD9, CD63, and TSG101. |
| 36080806 | Quantification of Serum Exosome Biomarkers Using 3D Nanoporous Gold and Spectrophotometry. | Furthermore, the specific binding between the exosome surface antibodies and the targets identified the CD63 biomarkers on the exosome, suggesting these markers' diagnostic potential. We quantified the expression of CD63 surface protein markers on exosomes from conditioned culture media of breast cancer cells. |