Protein detail
GNAO
Guanine nucleotide-binding protein G(o) subunit alpha (EC 3.6.5.-)
Protein symbol GNAO | UniProt ID | EVMP score 0.38 |
Frequency | Transmembrane count | Protein classification Disease related genesHuman disease related genesPredicted intracellular proteins |
Basic Information
Protein Names
Guanine nucleotide-binding protein G(o) subunit alpha (EC 3.6.5.-)
Protein Class
Disease related genesHuman disease related genesPredicted intracellular proteins
Protein Function
- Human disease related genes:Nervous system diseases:Epilepsy
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Gene Synonym
G-ALPHA-o
Gene Description
G protein subunit alpha o1
Chromosome
16
Position
56191390-56357444
EVMP Score
0.38
Fluorescence & Localization
Cell SpecificColonocytesSingle-Nuclei Brain Specificendothelial cellBlood Cell Specificplasmacytoid DC
Function & Pathway
Protein Function
- Human disease related genes:Nervous system diseases:Epilepsy
- Disease related genes
- Predicted intracellular proteins
Cellular Component
- GO:0005737 cytoplasm
- GO:0005834 heterotrimeric G-protein complex
- GO:0005886 plasma membrane
- GO:0030425 dendrite
- GO:0042734 presynaptic membrane
- GO:0044297 cell body
- GO:0045211 postsynaptic membrane
- GO:0098688 parallel fiber to Purkinje cell synapse
- GO:0098978 glutamatergic synapse
- GO:0098982 GABA-ergic synapse
Molecular Function
- GO:0003924 GTPase activity
- GO:0003925 G protein activity
- GO:0005515 protein binding
- GO:0005525 GTP binding
- GO:0010854 adenylate cyclase regulator activity
- GO:0031683 G-protein beta/gamma-subunit complex binding
- GO:0031821 G protein-coupled serotonin receptor binding
- GO:0031852 mu-type opioid receptor binding
- GO:0046872 metal ion binding
- GO:0051430 corticotropin-releasing hormone receptor 1 binding
Biological Process
KEGG
- hsa04015 Rap1 signaling pathway
- KEGG:hsa04081 Hormone signaling
- KEGG:hsa04082 Neuroactive ligand signaling
- KEGG:hsa04713 Circadian entrainment
- KEGG:hsa04723 Retrograde endocannabinoid signaling
- KEGG:hsa04724 Glutamatergic synapse
- KEGG:hsa04725 Cholinergic synapse
- KEGG:hsa04726 Serotonergic synapse
- KEGG:hsa04727 GABAergic synapse
- KEGG:hsa04728 Dopaminergic synapse
- KEGG:hsa04730 Long-term depression
- KEGG:hsa04915 Estrogen signaling pathway
- KEGG:hsa04916 Melanogenesis
- KEGG:hsa04921 Oxytocin signaling pathway
- KEGG:hsa04926 Relaxin signaling pathway
- KEGG:hsa05032 Morphine addiction
- KEGG:hsa05034 Alcoholism
- KEGG:hsa05142 Chagas disease
- KEGG:hsa05145 Toxoplasmosis
- KEGG:hsa05163 Human cytomegalovirus infection
- KEGG:hsa05170 Human immunodeficiency virus 1 infection
Reactome
Mediation Categories
Fusion and delivery mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
0 records.
Ligand-Receptor Signaling
6 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | LOCATE | No | No | No | No | No |
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Regulatory Interaction Network
93 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| OPRX | P41146 | GNAO | P09471 | Yes | Yes | No | WangCui2007SIGNORCA1 | CA1:15082510SIGNOR:31160049 |
| NPFF1 | Q9GZQ6 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| LPAR3 | Q9UBY5 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| PAR1 | P25116 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| SSR5 | P35346 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| OX1R | O43613 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| P2Y13 | Q9BPV8 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| AA2BR | P29275 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| GPR34 | Q9UPC5 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
| 5HT7R | P34969 | GNAO | P09471 | Yes | Yes | No | SIGNOR | SIGNOR:31160049 |
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster217 | ARHGAP32GNAI1GNAO1GPSM1GPSM2 | A7KAX9P09471P63096P81274Q86YR5 | 1:1:1:1:1 | Compleat | Compleat:HC3307 | 22036573 |
| GNAI1GNAO1GPSM2HAUS6KLHL3NEDD1UBC | P09471P0CG48P63096P81274Q7Z4H7Q8NHV4Q9UH77 | 1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5187 | ||
| BECN1GNAI1GNAO1ILKAPNGBPIK3C3PIK3R4UBC | P09471P0CG48P63096Q14457Q8NEB9Q99570Q9H0C8Q9NPG2 | 1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC5488 | ||
| GNAO1KLHL3OPRD1OPRM1 | P09471P35372P41143Q9UH77 | 1:1:1:1 | CompleatCFinder | Compleat:HC8911 |
Isolation & Detection Technology
0 records.
Sequence, Structure & Domains
Sequences
Length
354
Mass
40,051
Sequence
MGCTLSAEERAALERSKAIEKNLKEDGISAAKDVKLLLLGAGESGKSTIVKQMKIIHEDGFSGEDVKQYKPVVYSNTIQSLAAIVRAMDTLGIEYGDKERKADAKMVCDVVSRMEDTEPFSAELLSAMMRLWGDSGIQECFNRSREYQLNDSAKYYLDSLDRIGAADYQPTEQDILRTRVKTTGIVETHFTFKNLHFRLFDVGGQRSERKKWIHCFEDVTAIIFCVALSGYDQVLHEDETTNRMHESLMLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=Alpha-1; IsoId=P09471-1; Sequence=Displayed; Name=Alpha-2; IsoId=P09471-2, P29777-1; Sequence=VSP_031250
Alternative Sequence
249..354; MLFDSICNNKFFIDTSIILFLNKKDLFGEKIKKSPLTICFPEYTGPNTYEDAAAYIQAQFESKNRSPNKEIYCHMTCATDTNNIQVVFDAVTDIIIANNLRGCGLY -> KLFDSICNNKWFTDTSIILFLNKKDIFEEKIKKSPLTICFPEYTGPSAFTEAVAYIQAQYESKNKSAHKEIYTHVTCATDTNNIQFVFDAVTDVIIAKNLRGCGLY (in isoform Alpha-2)
3D Structural Models
Turn
51..53; 143..146; 180..182; 236..238; 284..287
Helix
7..31; 46..48; 64..68; 70..91; 99..112; 122..132; 135..142; 151..158; 160..165; 202..204; 209..211; 213..216; 242..255; 272..281; 297..310; 332..350
Beta Strand
34..45; 186..194; 196..201; 220..229; 231..233; 258..262; 264..270; 294..296; 314..316; 320..323; 326..328
3D Structure
Electron microscopy (60); X-ray crystallography (1)
Domain & Motif Annotations
Domain (FT)
32..354; G-alpha
Region
35..48; G1 motif; 174..182; G2 motif; 197..206; G3 motif; 266..273; G4 motif; 324..329; G5 motif
Protein Families
- G-alpha family
- G(i/o/t/z) subfamily
Sequence Similarities
Belongs to the G-alpha family. G(i/o/t/z) subfamily.