Protein detail
HMOX1
Heme oxygenase 1 (HO-1) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 1 soluble form]
Protein symbol HMOX1 | UniProt ID | EVMP score 0.72 |
Frequency 18 | Transmembrane count 1 | Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins |
Basic Information
Protein Names
Heme oxygenase 1 (HO-1) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 1 soluble form]
Protein Class
Cancer-related genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins
Protein Function
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
- Potential drug targets
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Respiratory diseases:Lung diseases
- Disease related genes
Transmembrane
266..288; Helical; Anchor for type IV membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym
bK286B10HO-1
Gene Description
Heme oxygenase 1
Chromosome
22
Position
35380361-35394214
Frequency
18
EVMP Score
0.72
Fluorescence & Localization
Function & Pathway
Protein Function
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
- Potential drug targets
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Respiratory diseases:Lung diseases
- Disease related genes
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa00860 Porphyrin metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04066 HIF-1 signaling pathway
- KEGG:hsa04216 Ferroptosis
- KEGG:hsa04978 Mineral absorption
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05206 MicroRNAs in cancer
- KEGG:hsa05208 Chemical carcinogenesis - reactive oxygen species
- KEGG:hsa05225 Hepatocellular carcinoma
- KEGG:hsa05418 Fluid shear stress and atherosclerosis
Reactome
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-9711123 cellular response to chemical stress
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-9707564 cytoprotection by hmox1
- R-hsa-189483 heme degradation
- R-hsa-9707616 heme signaling
- R-hsa-5663205 infectious disease
- R-hsa-622312 inflammasomes
- R-hsa-168249 innate immune system
- R-hsa-9609523 insertion of tail anchored proteins into the endoplasmic reticulum membrane
- R-hsa-6785807 interleukin 4 and interleukin 13 signaling
- R-hsa-917937 iron uptake and transport
- R-hsa-9755511 keap1 nfe2l2 pathway
- R-hsa-9658195 leishmania infection
- R-hsa-189445 metabolism of porphyrins
- R-hsa-9818027 nfe2l2 regulating anti oxidant detoxification enzymes
- R-hsa-9759194 nuclear events mediated by nfe2l2
- R-hsa-168643 nucleotide binding domain leucine rich repeat containing receptor nlr signaling pathways
- R-hsa-9609507 protein localization
- R-hsa-9660826 purinergic signaling in leishmaniasis infection
- R-hsa-9707587 regulation of hmox1 expression and activity
- R-hsa-449147 signaling by interleukins
- R-hsa-844456 the nlrp3 inflammasome
- R-hsa-382551 transport of small molecules
Mediation Categories
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| HMOX1 | AKT1 | P31749 | S | 188 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:15581622SIGNOR:15581622ProtMapper:15581622KEA:15581622 |
| HMOX1 | PTEN | P60484 | S | 188 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:18691077 |
Ligand-Receptor Signaling
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane_predicted | transmembrane | OmniPath | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| receptor | receptor | scConnect | No | Yes | No | No | No |
| transmembrane | transmembrane_predicted | Phobius | No | No | No | No | No |
| transmembrane_phobius | transmembrane_predicted | Almen2009 | No | No | No | No | No |
Regulatory Interaction Network
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AKT1 | P31749 | HMOX1 | P09601 | Yes | Yes | No | WangPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDRLIMS-P_ProtMapperPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | ProtMapper:15581622HPRD-phos:15581622HPRD:15581622KEA:15581622SIGNOR:15581622PhosphoSite:15581622 |
| HMOX1 | P09601 | HBA | P69905 | Yes | No | Yes | SIGNOR | SIGNOR:10490932 |
Protein Complex Composition
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster193 | FDPSHMOX1HMOX2SSBP1 | P09601P14324P30519Q04837 | 1:1:1:1 | Compleat | Compleat:HC2811 | 22036573 |
| STC2/HMOX1 | HMOX1STC2 | O76061P09601 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C244 | |
| HMOX1 | P09601 | 2 | PDB | PDB:1ni6PDB:3czyPDB:3tgmPDB:1xk1PDB:1twnPDB:1xk3PDB:1n3uPDB:3k4fPDB:1xk2PDB:1twrPDB:1oykPDB:1ozePDB:1ozlPDB:1xjzPDB:1s8cPDB:1n45PDB:1ozrPDB:5btqPDB:1t5pPDB:1xk0PDB:4wd4PDB:6ehaPDB:1s13PDB:1oylPDB:3hokPDB:1ozw | ||
| HMOX1LRRC27 | P09601Q9C0I9 | 0:0 | hu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
288
Mass
32,819
Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
3D Structural Models
Turn
72..74
Helix
6..8; 13..20; 22..30; 32..38; 44..68; 75..77; 80..83; 86..97; 101..103; 109..124; 126..128; 129..155; 165..167; 175..188; 193..220
Beta Strand
159..161
3D Structure
X-ray crystallography (26)
Domain & Motif Annotations
Domain (CC)
The transmembrane domain is necessary for its oligomerization.
Region
223..260; Disordered
Protein Families
Heme oxygenase family
Sequence Similarities
Belongs to the heme oxygenase family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Related Diseases
Biomarker
Phase 2
Drugs