Protein detail
HMOX1
Heme oxygenase 1 (HO-1) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 1 soluble form]
Entry name HMOX1 | UniProt ID | EVMP confidence score 0.72 |
Supporting publications (n) 18 | Transmembrane count 1 | Protein classification Cancer-related genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Heme oxygenase 1 (HO-1) (EC 1.14.14.18) [Cleaved into: Heme oxygenase 1 soluble form]
Protein Class (8)
Cancer-related genesDisease related genesEnzymesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted intracellular proteinsPredicted membrane proteins
Protein Function (7)
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
- Potential drug targets
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Respiratory diseases:Lung diseases
- Disease related genes
Transmembrane
266..288; Helical; Anchor for type IV membrane protein
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
bK286B10HO-1
Gene Description
Heme oxygenase 1
Chromosome
22
Position
35380361-35394214
Supporting publications (n)
18
EVMP confidence score
0.72
Fluorescence & Localization
Function & Pathway
Protein Function (7)
- ENZYME proteins:Oxidoreductases
- Predicted intracellular proteins
- Potential drug targets
- Enzymes
- Cancer-related genes:Candidate cancer biomarkers
- Human disease related genes:Respiratory diseases:Lung diseases
- Disease related genes
Cellular Component (9)
Molecular Function (8)
Biological Process (3)
KEGG (10)
- hsa00860 Porphyrin metabolism
- KEGG:hsa01100 Metabolic pathways
- KEGG:hsa04066 HIF-1 signaling pathway
- KEGG:hsa04216 Ferroptosis
- KEGG:hsa04978 Mineral absorption
- KEGG:hsa05200 Pathways in cancer
- KEGG:hsa05206 MicroRNAs in cancer
- KEGG:hsa05208 Chemical carcinogenesis - reactive oxygen species
- KEGG:hsa05225 Hepatocellular carcinoma
- KEGG:hsa05418 Fluid shear stress and atherosclerosis
Reactome (24)
- R-hsa-8953897 cellular responses to stimuli
- R-hsa-9711123 cellular response to chemical stress
- R-hsa-1280215 cytokine signaling in immune system
- R-hsa-9707564 cytoprotection by hmox1
- R-hsa-189483 heme degradation
- R-hsa-9707616 heme signaling
- R-hsa-5663205 infectious disease
- R-hsa-622312 inflammasomes
- R-hsa-168249 innate immune system
- R-hsa-9609523 insertion of tail anchored proteins into the endoplasmic reticulum membrane
Page 1 of 3
Mediation Categories (5)
Clinical-translation mediationFusion and delivery mediationImmune mediationMetabolism mediationReceptor-signaling mediation
Relations & Evidence31
Enzyme-Mediated Modification (2)
2 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| HMOX1 | AKT1 | P31749 | S | 188 | phosphorylation | PhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDRLIMS-P_ProtMapperKEASIGNOR_ProtMapperPhosphoSitePhosphoSite_ProtMapper | HPRD:15581622SIGNOR:15581622ProtMapper:15581622KEA:15581622 |
| HMOX1 | PTEN | P60484 | S | 188 | phosphorylation | Sparser_ProtMapperProtMapper | ProtMapper:18691077 |
Ligand-Receptor Signaling (22)
22 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane_sosui | transmembrane_predicted | Almen2009 | |||||
| transmembrane_tmhmm | transmembrane_predicted | Almen2009 |
Page 3 of 3Previous
Regulatory Interaction Network (2)
2 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| AKT1 | P31749 | HMOX1 | P09601 | Yes | Yes | WangPhosphoSite_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDRLIMS-P_ProtMapperPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperPhosphoSiteHPRD-phosPhosphoSite_ProtMapper | ProtMapper:15581622HPRD-phos:15581622HPRD:15581622KEA:15581622SIGNOR:15581622PhosphoSite:15581622 | |
| HMOX1 | P09601 | HBA | P69905 | Yes | Yes | SIGNOR | SIGNOR:10490932 |
Protein Complex Composition (4)
4 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| HT_DM_Cluster193 | FDPSHMOX1HMOX2SSBP1 | P09601P14324P30519Q04837 | 1:1:1:1 | Compleat | Compleat:HC2811 | 22036573 |
| STC2/HMOX1 | HMOX1STC2 | O76061P09601 | 0:0 | SIGNOR | SIGNOR:SIGNOR-C244 | |
| HMOX1 | P09601 | 2 | PDB | PDB:1ni6PDB:3czyPDB:3tgmPDB:1xk1PDB:1twnPDB:1xk3PDB:1n3uPDB:3k4fPDB:1xk2PDB:1twrPDB:1oykPDB:1ozePDB:1ozlPDB:1xjzPDB:1s8cPDB:1n45PDB:1ozrPDB:5btqPDB:1t5pPDB:1xk0PDB:4wd4PDB:6ehaPDB:1s13PDB:1oylPDB:3hokPDB:1ozw | ||
| HMOX1LRRC27 | P09601Q9C0I9 | 0:0 | hu.MAP2 |
Sequence, Structure & Domains
Sequences
Length
288
Mass
32,819
Sequence
MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM
3D Structural Models
Turn
72..74
Helix
6..8; 13..20; 22..30; 32..38; 44..68; 75..77; 80..83; 86..97; 101..103; 109..124; 126..128; 129..155; 165..167; 175..188; 193..220
Beta Strand
159..161
3D Structure
X-ray crystallography (26)
Domain & Motif Annotations
Domain (CC)
The transmembrane domain is necessary for its oligomerization.
Region
223..260; Disordered
Protein Families
Heme oxygenase family
Sequence Similarities
Belongs to the heme oxygenase family.
Clinical Relevance
Disease Involvement
Cancer-related genes
Related Diseases
Biomarker
Phase 2
Drugs (10)
Supporting Publications18
| PMID | Title | Related sentences |
|---|---|---|
| 39949490 | CRISPR-dCas9 Activation of TSG-6 in MSCs Modulates the Cargo of MSC-Derived Extracellular Vesicles and Attenuates Inflammatory Responses in Human Intervertebral Disc Cells In Vitro. | No related sentences available |
| 40091455 | Potential Role of Menstrual Fluid-Derived Small Extracellular Vesicle Proteins in Endometriosis Pathogenesiss. | No related sentences available |
| 40098346 | Toward Identification of Markers for Brain-Derived Extracellular Vesicles in Cerebrospinal Fluid: A Large-Scale, Unbiased Analysis Using Proximity Extension Assays. | No related sentences available |
| 40311616 | Integrative proteomic profiling of tumor and plasma extracellular vesicles identifies a diagnostic biomarker panel for colorectal cancer. | No related sentences available |
| 40784529 | Serum-derived exosome proteomics unveils the distinct and adjustable nature of the dampness constitution in traditional Chinese medicine. | No related sentences available |
| 41201090 | Identification of molecular markers and exploration of the oncogenic role of exomeres in hepatocellular carcinoma. | No related sentences available |
| 41216884 | Extracellular Vesicles From Multiple Sclerosis White Matter Exhibit Synaptic, Mitochondrial, Complement and Ageing-Related Pathway Dysregulation. | No related sentences available |
| 41315767 | Multi-omics identify hallmark protein and lipid features of small extracellular vesicles circulating in human plasma. | No related sentences available |
Page 2 of 2Previous