Protein detail

TACD2

Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)

Entry name TACD2	UniProt ID P09758	EVMP confidence score 0.72
Supporting publications (n) 16	Transmembrane count 1	Protein classification Disease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins

EVMP confidence score

Annotation confidence score; open for threshold definitions.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information13

Protein Names

Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)

Protein Class (4)

Disease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins

Protein Function (3)

Disease related genes
Human disease related genes:Nervous system diseases:Eye disease
FDA approved drug targets:Biotech drugs

Transmembrane

275..297; Helical

Transmembrane Count

Ensembl

ENSG00000184292

Entrez Gene Symbol

TACSTD2

Gene Synonym (4)

EGP-1GA733-1M1S1TROP2

Gene Description

Tumor associated calcium signal transducer 2

Chromosome

Position

58575433-58577252

Supporting publications (n)

EVMP confidence score

0.72

Function & Pathway5

Protein Function (3)

Disease related genes
Human disease related genes:Nervous system diseases:Eye disease
FDA approved drug targets:Biotech drugs

Cellular Component (7)

Molecular Function

GO:0005515 protein binding

Biological Process (3)

Mediation Categories (3)

Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediation

Relations & Evidence31

Enzyme-Mediated Modification (3)

3 records.

Substrate Gene Symbol	Enzyme Gene Symbol	Enzyme UniProt ID	Residue Type	Residue Offset	Modification	Database	References
TACSTD2	PRKCA	P17252	S	303	phosphorylation	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMPhosphoSitePhosphoSite_ProtMapper	phosphoELM:7635574 KEA:7635574
TACSTD2	PRKCA	P17252	S	322	phosphorylation	PhosphoSite
TACSTD2	PRKCD	Q05655	S	322	phosphorylation	PhosphoSite

Ligand-Receptor Signaling (23)

23 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
receptor	receptor	OmniPath	No	Yes	No	Yes	No
extracellular	extracellular	OmniPath	No	No	No	Yes	No
intracellular	intracellular	ComPPI	No	No	No	Yes	No
intracellular	intracellular	GO_Intercell	No	No	No	Yes	No
intracellular	intracellular	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_location	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_topology	No	No	No	Yes	No
transmembrane	transmembrane	UniProt_keyword	No	No	No	Yes	No
transmembrane_predicted	transmembrane	OmniPath	No	No	No	Yes	No
transmembrane	transmembrane	TopDB	No	No	No	Yes	No

Page 1 of 3Next

Regulatory Interaction Network (3)

3 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
KPCD	Q05655	TACD2	P09758	Yes	No	Yes	SIGNORPhosphoSite_ProtMapperProtMapper	SIGNOR:31177095
TACD2	P09758	CLD7	O95471	Yes	Yes	No	HINTLit-BM-17SIGNOR	Lit-BM-17:20651236 HINT:20651236 SIGNOR:31177095 HINT:33961781
KPCA	P17252	TACD2	P09758	Yes	No	Yes	PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMPhosphoSitePhosphoSite_ProtMapper	KEA:7635574 phosphoELM:7635574 SIGNOR:31177095 PhosphoSite:31177095 PhosphoSite:25981199 PhosphoSite:7635574

Protein Complex Composition (1)

1 record.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
	TACSTD2	P09758	2	PDB	PDB:7e5nPDB:7e5mPDB:7pee

Isolation & Detection Technology (1)

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationSize Exclusion Chromatography	Mass spectrometry	1	30865381

Sequence, Structure & Domains10

Sequences

Length

323

Mass

35,709

Sequence

MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL

3D Structural Models

Turn

58..60; 121..123

Helix

49..51; 72..80; 169..182; 188..190; 209..211; 219..230; 299..317

Beta Strand

41..46; 54..57; 97..99; 112..114; 116..120; 124..129; 151..160; 191..197; 200..206; 237..239; 253..264

3D Structure

NMR spectroscopy (3); X-ray crystallography (3)

Domain & Motif Annotations

Domain (FT)

70..145; Thyroglobulin type-1

Protein Families

EPCAM family

Sequence Similarities

Belongs to the EPCAM family.

Clinical Relevance6

Disease Involvement (3)

AmyloidosisCorneal dystrophyFDA approved drug targets

Related Diseases (4)

Breast cancer Non-small-cell lung cancer Solid tumour/cancer Ureteral cancer

Biomarker

Approved; Phase 3; Phase 1/2

Drug Targets

FDA approved drug targets

Drugs (2)

DS-1062 SACITUZUMAB GOVITECAN

Antibody (3)

HPA043104 HPA055067 CAB072852

Supporting Publications16

PMID	Title	Abstract
34817906	Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform.	No abstract available
35611462	Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients.	No abstract available
37786918	Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples.	No abstract available
38168906	Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis.	No abstract available
39948040	Quantitative proteomics identifies possible flow of metastatic cues between progressive stages of colorectal cancer via transfer of ceramide-dependent exosomal cargoes.	No abstract available
40089067	Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells.	No abstract available

Page 2 of 2Previous