Protein detail
TACD2
Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)
Entry name TACD2 | UniProt ID | EVMP confidence score 0.47 |
Supporting publications (n) 16 | Transmembrane count 1 | Protein classification Disease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Tumor-associated calcium signal transducer 2 (Cell surface glycoprotein Trop-2) (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1)
Protein Class (4)
Disease related genesFDA approved drug targetsHuman disease related genesPredicted membrane proteins
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
- FDA approved drug targets:Biotech drugs
Transmembrane
275..297; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Synonym (4)
EGP-1GA733-1M1S1TROP2
Gene Description
Tumor associated calcium signal transducer 2
Chromosome
1
Position
58575433-58577252
Supporting publications (n)
16
EVMP confidence score
0.47
Function & Pathway
Protein Function (3)
- Disease related genes
- Human disease related genes:Nervous system diseases:Eye disease
- FDA approved drug targets:Biotech drugs
Cellular Component (7)
Molecular Function
Biological Process (3)
Mediation Categories (3)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediation
Relations & Evidence31
Enzyme-Mediated Modification (3)
3 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| TACSTD2 | PRKCA | P17252 | S | 303 | phosphorylation | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPProtMapperKEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | phosphoELM:7635574KEA:7635574 |
| TACSTD2 | PRKCA | P17252 | S | 322 | phosphorylation | PhosphoSite | |
| TACSTD2 | PRKCD | Q05655 | S | 322 | phosphorylation | PhosphoSite |
Ligand-Receptor Signaling (23)
23 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | OmniPath | Yes | Yes | |||
| extracellular | extracellular | OmniPath | Yes | ||||
| intracellular | intracellular | ComPPI | Yes | ||||
| intracellular | intracellular | GO_Intercell | Yes | ||||
| intracellular | intracellular | OmniPath | Yes | ||||
| transmembrane | transmembrane | UniProt_location | Yes | ||||
| transmembrane | transmembrane | UniProt_topology | Yes | ||||
| transmembrane | transmembrane | UniProt_keyword | Yes | ||||
| transmembrane_predicted | transmembrane | OmniPath | Yes | ||||
| transmembrane | transmembrane | TopDB | Yes |
Page 1 of 3Next
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KPCD | Q05655 | TACD2 | P09758 | Yes | Yes | SIGNORPhosphoSite_ProtMapperProtMapper | SIGNOR:31177095 | |
| TACD2 | P09758 | CLD7 | O95471 | Yes | Yes | HINTLit-BM-17SIGNOR | Lit-BM-17:20651236HINT:20651236SIGNOR:31177095HINT:33961781 | |
| KPCA | P17252 | TACD2 | P09758 | Yes | Yes | PhosphoNetworksphosphoELM_MIMPPhosphoSite_MIMPMIMPiPTMnetSIGNORProtMapperPhosphoSite_KEAKEAphosphoELM_KEAphosphoELMPhosphoSitePhosphoSite_ProtMapper | KEA:7635574phosphoELM:7635574SIGNOR:31177095PhosphoSite:31177095PhosphoSite:25981199PhosphoSite:7635574 |
Protein Complex Composition (1)
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential UltracentrifugationSize Exclusion Chromatography | Mass spectrometry | 1 | 30865381 |
Sequence, Structure & Domains
Sequences
Length
323
Mass
35,709
Sequence
MARGPGLAPPPLRLPLLLLVLAAVTGHTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLTAGLIAVIVVVVVALVAGMAVLVITNRRKSGKYKKVEIKELGELRKEPSL
3D Structural Models
Turn
58..60; 121..123
Helix
49..51; 72..80; 169..182; 188..190; 209..211; 219..230; 299..317
Beta Strand
41..46; 54..57; 97..99; 112..114; 116..120; 124..129; 151..160; 191..197; 200..206; 237..239; 253..264
3D Structure
NMR spectroscopy (3); X-ray crystallography (3)
Domain & Motif Annotations
Domain (FT)
70..145; Thyroglobulin type-1
Protein Families
EPCAM family
Sequence Similarities
Belongs to the EPCAM family.
Clinical Relevance
Disease Involvement (3)
AmyloidosisCorneal dystrophyFDA approved drug targets
Related Diseases (6)
Biomarker
Approved; Phase 3; Phase 1/2
Drug Targets
FDA approved drug targets
Drugs (2)
Supporting Publications16
| PMID | Title | Related sentences |
|---|---|---|
| 34817906 | Proteomic dissection of large extracellular vesicle surfaceome unravels interactive surface platform. | No related sentences available |
| 35611462 | Extracellular vesicles expressing CEACAM proteins in the urine of bladder cancer patients. | No related sentences available |
| 37786918 | Rapid and in-depth proteomic profiling of small extracellular vesicles for ultralow samples. | No related sentences available |
| 38168906 | Defining the relationship between cellular and extracellular vesicle (EV) content in breast cancer via an integrative multi-omic analysis. | No related sentences available |
| 39948040 | Quantitative proteomics identifies possible flow of metastatic cues between progressive stages of colorectal cancer via transfer of ceramide-dependent exosomal cargoes. | No related sentences available |
| 40089067 | Metabolic Reprogramming Into a Glycolysis Phenotype Induced by Extracellular Vesicles Derived From Prostate Cancer Cells. | No related sentences available |
Page 2 of 2Previous