Protein detail

FBSP1

F-box/SPRY domain-containing protein 1 (F-box only protein 45) (hFbxo45)

Protein symbol FBSP1	UniProt ID P0C2W1	EVMP score 0.50
Frequency 1	Transmembrane count	Protein classification Predicted intracellular proteinsPredicted secreted proteins

EVMP score: annotation confidence score.

Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40

Basic Information

Protein Names

F-box/SPRY domain-containing protein 1 (F-box only protein 45) (hFbxo45)

Protein Class

Predicted intracellular proteinsPredicted secreted proteins

Protein Function

Predicted secreted proteins
Predicted intracellular proteins

Ensembl

ENSG00000174013

Entrez Gene Symbol

FBXO45

Gene Synonym

Fbx45

Gene Description

F-box protein 45

Chromosome

Position

196568611-196589059

Frequency

EVMP Score

0.50

Fluorescence & Localization

Tissue SpecificbrainCell SpecificMast cellsBlood Cell Specificclassical monocyteBlood Lineage Specificdendritic cells

Function & Pathway

Protein Function

Predicted secreted proteins
Predicted intracellular proteins

Cellular Component

Molecular Function

Biological Process

Canonical Pathways

M5880 Naba ecm affiliated
M5885 Naba matrisome associated
M5889 Naba matrisome

Mediation Categories

Fusion and delivery mediation

Relations & Evidence

Enzyme-Mediated Modification

0 records.

Ligand-Receptor Signaling

10 records.

Category	Parent	Database	Transmitter	Receiver	Secreted	Plasma Membrane (Transmembrane)	Plasma Membrane (Peripheral)
ecm	ecm	MatrixDB	Yes	No	Yes	No	No
ecm	ecm	OmniPath	Yes	No	Yes	No	No
extracellular	extracellular	OmniPath	No	No	Yes	No	No
intracellular	intracellular	ComPPI	No	No	Yes	No	No
intracellular	intracellular	GO_Intercell	No	No	Yes	No	No
intracellular	intracellular	UniProt_location	No	No	Yes	No	No
intracellular	intracellular	OmniPath	No	No	Yes	No	No
secreted	secreted	UniProt_keyword	No	No	Yes	No	No
secreted	secreted	UniProt_location	No	No	Yes	No	No
secreted	secreted	OmniPath	No	No	Yes	No	No

Regulatory Interaction Network

9 records.

Source Protein Symbol	Source UniProt ID	Target Protein Symbol	Target UniProt ID	Is Directed	Is Stimulation	Is Inhibition	Database	References
FBSP1	P0C2W1	ZEB2	O60315	Yes	No	Yes	SIGNOR	SIGNOR:25460509
FBSP1	P0C2W1	TWST1	Q15672	Yes	No	Yes	SIGNOR	SIGNOR:25460509
FBSP1	P0C2W1	ZEB1	P37275	Yes	No	Yes	SIGNOR	SIGNOR:25460509
FBSP1	P0C2W1		COMPLEX:P62877_P63208_Q13616	Yes	Yes	No	SIGNOR	SIGNOR:19581926
FBSP1	P0C2W1	PAWR	Q96IZ0	Yes	No	Yes	SIGNORBioGRID	SIGNOR:24992930 BioGRID:28625975
FBSP1	P0C2W1	SNAI2	O43623	Yes	No	Yes	SIGNOR	SIGNOR:25460509
FBSP1	P0C2W1	P73	O15350	Yes	Yes	Yes	WangSIGNORACSN	ACSN:19581926 SIGNOR:19581926
FBSP1	P0C2W1		COMPLEX:O75592_P63208	Yes	Yes	No	SIGNOR	SIGNOR:24992930
FBSP1	P0C2W1	SNAI1	O95863	Yes	No	Yes	SIGNOR	SIGNOR:25460509

Protein Complex Composition

9 records.

Component Name	Component Gene Symbols	Component UniProt ID	Stoichiometry	Database	Database IDs	References
HT_DM_Cluster43	AMY1C AMY2A AMY2B CUL1 CYCS FBXO45 RAI1 SKP1	P04746 P0C2W1 P0DTE8 P19961 P63208 P99999 Q13616 Q7Z5J4	1:1:3:1:1:1:1:1	Compleat	Compleat:HC114	22036573
Non-canonical FBXO45-MYCBP2-SKP1 E3 ubiquitin ligase complex	FBXO45 MYCBP2 SKP1	O75592 P0C2W1 P63208	1:1:1	ComplexPortal	intact:EBI-44452758	29997255 14755292 15520277 34445249
	CUL1 FBXL12 FBXO11 FBXO33 FBXO42 FBXO45 RBX1 SKP1 TP53 TP73	O15350 P04637 P0C2W1 P62877 P63208 Q13616 Q6P3S6 Q7Z6M2 Q86XK2 Q9NXK8	1:1:1:1:1:1:1:1:1:1	NetworkBlastCompleat	Compleat:HC6726
	FBXO45 LGALS3BP MYCBP2	O75592 P0C2W1 Q08380	0:0:0	hu.MAP
	FBXO45 FBXW7 MYCBP2 PRR36 SNX8	O75592 P0C2W1 Q969H0 Q9H6K5 Q9Y5X2	0:0:0:0:0	hu.MAP2
	DPP9 FBXO45 IRF9 STAT1 STAT2 WARS2 ZNF692	P0C2W1 P42224 P52630 Q00978 Q86TI2 Q9BU19 Q9UGM6	0:0:0:0:0:0:0	hu.MAP2
	FBXO45 LGALS3BP	P0C2W1 Q08380	0:0	hu.MAP
	FBXO45 LGALS3BP SPRYD3	P0C2W1 Q08380 Q8NCJ5	0:0:0	hu.MAP
	FBXO45 FBXW7 PRR36	P0C2W1 Q969H0 Q9H6K5	0:0:0	hu.MAP2

Isolation & Detection Technology

1 record.

EV Isolation Method	Detection Method	Number of References	References
Differential UltracentrifugationDensity Gradient CentrifugationSize Exclusion Chromatography	Mass spectrometry	2	32284825 34817906

Sequence, Structure & Domains

Sequences

Length

286

Mass

30,633

Sequence

MAAPAPGAGAASGGAGCSGGGAGAGAGSGSGAAGAGGRLPSRVLELVFSYLELSELRSCALVCKHWYRCLHGDENSEVWRSLCARSLAEEALRTDILCNLPSYKAKIRAFQHAFSTNDCSRNVYIKKNGFTLHRNPIAQSTDGARTKIGFSEGRHAWEVWWEGPLGTVAVIGIATKRAPMQCQGYVALLGSDDQSWGWNLVDNNLLHNGEVNGSFPQCNNAPKYQIGERIRVILDMEDKTLAFERGYEFLGVAFRGLPKVCLYPAVSAVYGNTEVTLVYLGKPLDG

3D Structural Models

Domain & Motif Annotations

Domain (FT)

33..82; F-box; 92..284; B30.2/SPRY

Protein Families

FBXO45/Fsn family

Sequence Similarities

Belongs to the FBXO45/Fsn family.

Clinical Relevance

Antibody

HPA040730 HPA075467

Interaction Protein

ENSG00000005810ENSG00000113558

Interaction Count

Interaction Dataset

intact_biogridbiogrid_bioplex