Protein detail
CD28
T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28)
Protein symbol CD28 | UniProt ID | EVMP score 0.50 |
Frequency 2 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteins |
Basic Information
Protein Names
T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28)
Protein Class
CD markersPredicted membrane proteins
Protein Function
CD markers
Transmembrane
153..179; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
CD28 molecule
Chromosome
2
Position
203706475-203738912
Frequency
2
EVMP Score
0.50
Fluorescence & Localization
Cell SpecificEnterocytesSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionReceptor
Function & Pathway
Protein Function
CD markers
Cellular Component
Molecular Function
Biological Process
KEGG
- hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05162 Measles
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05322 Systemic lupus erythematosus
- KEGG:hsa05323 Rheumatoid arthritis
- KEGG:hsa05330 Allograft rejection
- KEGG:hsa05332 Graft-versus-host disease
- KEGG:hsa05416 Viral myocarditis
Reactome
- R-hsa-1280218 adaptive immune system
- R-hsa-389357 cd28 dependent pi3k akt signaling
- R-hsa-389359 cd28 dependent vav1 pathway
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-389356 co stimulation by cd28
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
- R-hsa-5663205 infectious disease
- R-hsa-9006925 intracellular signaling by second messengers
- R-hsa-164938 nef mediates down modulation of cell surface receptors by recruiting them to clathrin adapters
- R-hsa-199418 negative regulation of the pi3k akt network
- R-hsa-2219528 pi3k akt signaling in cancer
- R-hsa-388841 regulation of t cell activation by cd28 family
- R-hsa-164952 the role of nef in hiv 1 replication and disease pathogenesis
- R-hsa-9824446 viral infection pathways
Mediation Categories
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence
Enzyme-Mediated Modification
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD28 | ITK | Q08881 | Y | 209 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapper | SIGNOR:22936936HPRD:15144186phosphoELM:8992971KEA:15144186KEA:16094384KEA:8992971KEA:8946678SIGNOR:8992971KEA:15592455ProtMapper:22936936ProtMapper:8992971HPRD:19901323HPRD:8992971 |
| CD28 | ITK | Q08881 | Y | 218 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapper | HPRD:15144186phosphoELM:8992971KEA:15144186KEA:8992971KEA:8946678ProtMapper:8992971HPRD:8992971 |
| CD28 | ITK | Q08881 | Y | 191 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEAphosphoELMSIGNOR_ProtMapper | SIGNOR:22936936phosphoELM:8992971KEA:16094384KEA:8992971SIGNOR:8992971ProtMapper:22936936ProtMapper:8992971HPRD:19901323HPRD:8992971 |
| CD28 | ITK | Q08881 | Y | 206 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | KEA:8992971KEA:8946678SIGNOR:8992971ProtMapper:8992971HPRD:8992971 |
| CD28 | LCK | P06239 | Y | 191 | phosphorylation | phosphoELM_MIMPPhosphoSite_MIMPMIMPHPRD_MIMPSIGNORProtMapperRLIMS-P_ProtMapperReactome_ProtMapperKEAphosphoELMSIGNOR_ProtMapperREACH_ProtMapper | SIGNOR:22936936phosphoELM:8992971ProtMapper:27460989KEA:16094384KEA:8992971SIGNOR:8992971ProtMapper:22936936ProtMapper:8992971ProtMapper:7568038 |
| CD28 | LCK | P06239 | Y | 209 | phosphorylation | REACH_ProtMapperProtMapper | ProtMapper:27460989 |
| CD28 | SRC | P12931 | Y | 191 | phosphorylation | Li2012Reactome_ProtMapperProtMapper | |
| CD28 | TEC | P42680 | Y | 191 | phosphorylation | Li2012 | |
| CD28 | LYN | P07948 | Y | 191 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD28 | FYN | P06241 | Y | 191 | phosphorylation | Reactome_ProtMapperREACH_ProtMapperProtMapper | ProtMapper:7568038 |
Page 1 of 2Next
Ligand-Receptor Signaling
51 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane_predicted | Phobius | No | No | No | Yes | No |
Page 6 of 6Previous
Regulatory Interaction Network
10 records.
Protein Complex Composition
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CD28-transactivation complex | CD28NCL | P10747P19338 | 1:1 | CompleatCORUM | CORUM:92Compleat:HC3376 | 12324461 |
| CD28GRAP2 | O75791P10747 | 2:2 | PDB | PDB:5gjh | ||
| CD28 | P10747 | 2 | PDB | PDB:7vu5PDB:8s6z | ||
| CD28PIK3R1 | P10747P27986 | 1:1 | PDB | PDB:5gjiPDB:5aul | ||
| CD28GRB2 | P10747P62993 | 1:1 | PDB | PDB:3wa4 | ||
| CD28PTPN11 | P10747Q06124 | 1:1 | PDB | PDB:7ppn |
Isolation & Detection Technology
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains
Sequences
Length
220
Mass
25,066
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; IsoId=P10747-1; Sequence=Displayed; Name=2; Synonyms=CD28-S2; IsoId=P10747-2; Sequence=VSP_002494; Name=3; Synonyms=CD28i; IsoId=P10747-3; Sequence=VSP_002495; Name=4; Synonyms=CD28-S1; IsoId=P10747-4; Sequence=VSP_002496; Name=5; IsoId=P10747-5; Sequence=VSP_002495, VSP_002497, VSP_002498; Name=6; Synonyms=CD28-S3; IsoId=P10747-6; Sequence=VSP_002495, VSP_002499; Name=7; IsoId=P10747-7; Sequence=VSP_047701
Alternative Sequence
1..17; MLRLLLALNLFPSIQVT -> MPCGLSALIMCPKGMVAVVVAVDDGDSQALA (in isoform 7); 19..137; Missing (in isoform 2); 40..137; CKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKG -> W (in isoform 4); 40..124; CKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLD -> Y (in isoform 3, isoform 5 and isoform 6); 138..139; KH -> EE (in isoform 5); 140..220; Missing (in isoform 5); 152..207; Missing (in isoform 6)
3D Structural Models
Helix
104..106; 153..182
Beta Strand
27..30; 35..43; 49..58; 64..74; 77..79; 81..83; 85..90; 92..101; 108..121; 123..125; 131..134
3D Structure
NMR spectroscopy (2); X-ray crystallography (8)
Domain & Motif Annotations
Domain (FT)
28..137; Ig-like V-type
Region
198..220; Disordered
Clinical Relevance
Disease Involvement
Disease variant
Related Diseases
Biomarker
Phase 1/2; Discontinued in Phase 1; Investigative; Phase 2; Phase 1; Phase 3; Approved
Drugs