Protein detail
CD28
T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28)
Entry name CD28 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 2 | Transmembrane count 1 | Protein classification CD markersPredicted membrane proteins |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information12
Protein Names
T-cell-specific surface glycoprotein CD28 (TP44) (CD antigen CD28)
Protein Class (2)
CD markersPredicted membrane proteins
Protein Function
CD markers
Transmembrane
153..179; Helical
Transmembrane Count
1
Ensembl
Entrez Gene Symbol
Gene Description
CD28 molecule
Chromosome
2
Position
203706475-203738912
Supporting publications (n)
2
EVMP confidence score
0.50
Fluorescence & Localization7
Cell SpecificEnterocytesSingle-Nuclei Brain Specificcommitted oligodendrocyte precursorBlood Cell SpecificbasophilBlood Lineage SpecificgranulocytesSecretome LocationSecreted - unknown locationSecretome FunctionReceptor
Function & Pathway7
Protein Function
CD markers
Cellular Component (6)
Molecular Function (4)
Biological Process (3)
KEGG (13)
- hsa04514 Cell adhesion molecule (CAM) interaction
- KEGG:hsa04517 IgSF CAM signaling
- KEGG:hsa04660 T cell receptor signaling pathway
- KEGG:hsa04672 Intestinal immune network for IgA production
- KEGG:hsa04940 Type I diabetes mellitus
- KEGG:hsa05162 Measles
- KEGG:hsa05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
- KEGG:hsa05320 Autoimmune thyroid disease
- KEGG:hsa05322 Systemic lupus erythematosus
- KEGG:hsa05323 Rheumatoid arthritis
Page 1 of 2
Reactome (16)
- R-hsa-1280218 adaptive immune system
- R-hsa-389357 cd28 dependent pi3k akt signaling
- R-hsa-389359 cd28 dependent vav1 pathway
- R-hsa-2219530 constitutive signaling by aberrant pi3k in cancer
- R-hsa-389356 co stimulation by cd28
- R-hsa-5663202 diseases of signal transduction by growth factor receptors and second messengers
- R-hsa-162906 hiv infection
- R-hsa-162909 host interactions of hiv factors
- R-hsa-5663205 infectious disease
- R-hsa-9006925 intracellular signaling by second messengers
Page 1 of 2
Mediation Categories (5)
Adhesion and uptake mediationClinical-translation mediationFusion and delivery mediationImmune mediationReceptor-signaling mediation
Relations & Evidence80
Enzyme-Mediated Modification (12)
12 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| CD28 | YES1 | P07947 | Y | 191 | phosphorylation | Reactome_ProtMapperProtMapper | |
| CD28 | IGF1R | P08069 | Y | 191 | phosphorylation | KEA | KEA:17570479 |
Page 2 of 2Previous
Ligand-Receptor Signaling (51)
51 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| receptor | receptor | GO_Intercell | No | Yes | No | Yes | No |
| receptor | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | CellChatDB | No | Yes | No | Yes | No |
| receptor | receptor | CellTalkDB | No | Yes | No | Yes | No |
| receptor | receptor | Ramilowski2015 | No | Yes | No | Yes | No |
| receptor | receptor | LRdb | No | Yes | No | Yes | No |
| receptor | receptor | Baccin2019 | No | Yes | No | Yes | No |
| checkpoint | receptor | ICELLNET | No | Yes | No | Yes | No |
| checkpoint_b7 | receptor | ICELLNET | No | Yes | No | Yes | No |
| receptor | receptor | OmniPath | No | Yes | No | Yes | No |
Page 1 of 6Next
Regulatory Interaction Network (10)
10 records.
Protein Complex Composition (6)
6 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| CD28-transactivation complex | CD28NCL | P10747P19338 | 1:1 | CompleatCORUM | CORUM:92Compleat:HC3376 | 12324461 |
| CD28GRAP2 | O75791P10747 | 2:2 | PDB | PDB:5gjh | ||
| CD28 | P10747 | 2 | PDB | PDB:7vu5PDB:8s6z | ||
| CD28PIK3R1 | P10747P27986 | 1:1 | PDB | PDB:5gjiPDB:5aul | ||
| CD28GRB2 | P10747P62993 | 1:1 | PDB | PDB:3wa4 | ||
| CD28PTPN11 | P10747Q06124 | 1:1 | PDB | PDB:7ppn |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Polymer Precipitation | Western blotting | 1 | 38731868 |
Sequence, Structure & Domains10
Sequences
Length
220
Mass
25,066
Sequence
MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS
Alternative Products
Event=Alternative splicing; Named isoforms=7; Name=1; IsoId=P10747-1; Sequence=Displayed; Name=2; Synonyms=CD28-S2; IsoId=P10747-2; Sequence=VSP_002494; Name=3; Synonyms=CD28i; IsoId=P10747-3; Sequence=VSP_002495; Name=4; Synonyms=CD28-S1; IsoId=P10747-4; Sequence=VSP_002496; Name=5; IsoId=P10747-5; Sequence=VSP_002495, VSP_002497, VSP_002498; Name=6; Synonyms=CD28-S3; IsoId=P10747-6; Sequence=VSP_002495, VSP_002499; Name=7; IsoId=P10747-7; Sequence=VSP_047701
Alternative Sequence
1..17; MLRLLLALNLFPSIQVT -> MPCGLSALIMCPKGMVAVVVAVDDGDSQALA (in isoform 7); 19..137; Missing (in isoform 2); 40..137; CKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKG -> W (in isoform 4); 40..124; CKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQLQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLD -> Y (in isoform 3, isoform 5 and isoform 6); 138..139; KH -> EE (in isoform 5); 140..220; Missing (in isoform 5); 152..207; Missing (in isoform 6)
3D Structural Models
Helix
104..106; 153..182
Beta Strand
27..30; 35..43; 49..58; 64..74; 77..79; 81..83; 85..90; 92..101; 108..121; 123..125; 131..134
3D Structure
NMR spectroscopy (2); X-ray crystallography (8)
Domain & Motif Annotations
Domain (FT)
28..137; Ig-like V-type
Region
198..220; Disordered
Clinical Relevance5
Disease Involvement
Disease variant
Related Diseases (15)
Biomarker
Phase 1/2; Discontinued in Phase 1; Investigative; Phase 2; Phase 1; Phase 3; Approved
Drugs (16)