Protein detail
MCF2
Proto-oncogene DBL (Proto-oncogene MCF-2) [Cleaved into: MCF2-transforming protein; DBL-transforming protein]
Entry name MCF2 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count | Protein classification |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information6
Protein Names
Proto-oncogene DBL (Proto-oncogene MCF-2) [Cleaved into: MCF2-transforming protein; DBL-transforming protein]
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Ensembl
Entrez Gene Symbol
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificAstrocytes
Function & Pathway6
Protein Function (2)
- Disease related genes
- Predicted intracellular proteins
Cellular Component (5)
Molecular Function (2)
Biological Process (3)
Reactome (17)
- R-hsa-9013148 cdc42 gtpase cycle
- R-hsa-204998 cell death signalling via nrage nrif and nade
- R-hsa-73887 death receptor signaling
- R-hsa-416482 g alpha 12 13 signalling events
- R-hsa-193648 nrage signals death through jnk
- R-hsa-193697 p75ntr regulates axonogenesis
- R-hsa-193704 p75 ntr receptor mediated signalling
- R-hsa-9013149 rac1 gtpase cycle
- R-hsa-9013404 rac2 gtpase cycle
- R-hsa-9013423 rac3 gtpase cycle
Page 1 of 2
Mediation Categories
Receptor-signaling mediation
Relations & Evidence8
Ligand-Receptor Signaling (4)
4 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| intracellular | intracellular | ComPPI | No | No | No | No | No |
| intracellular | intracellular | GO_Intercell | No | No | No | No | No |
| intracellular | intracellular | UniProt_location | No | No | No | No | No |
| intracellular | intracellular | OmniPath | No | No | No | No | No |
Regulatory Interaction Network (3)
3 records.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| MCF2 | P10911 | RAC1 | P63000 | Yes | Yes | No | WangSIGNOR | SIGNOR:32203420 |
| MCF2 | P10911 | CDC42 | P60953 | Yes | Yes | No | WangHINTSIGNORACSN | ACSN:10816584ACSN:9113980ACSN:17045588HINT:10854437HINT:32203420ACSN:9490022ACSN:8836113SIGNOR:32203420 |
| MCF2 | P10911 | RHOA | P61586 | Yes | Yes | No | WangHPRDHINTSIGNOR | HPRD:10854437HINT:10854437SIGNOR:32203420HINT:32203420 |
Sequence, Structure & Domains10
Sequences
Length
925
Mass
107,673
Sequence
MAEANPRRGKMRFRRNAASFPGNLHLVLVLRPTSFLQRTFTDIGFWFSQEDFMLKLPVVMLSSVSDLLTYIDDKQLTPELGGTLQYCHSEWIIFRNAIENFALTVKEMAQMLQSFGTELAETELPDDIPSIEEILAIRAERYHLLKNDITAVTKEGKILLTNLEVPDTEGAVSSRLECHRQISGDWQTINKLLTQVHDMETAFDGFWEKHQLKMEQYLQLWKFEQDFQQLVTEVEFLLNQQAELADVTGTIAQVKQKIKKLENLDENSQELLSKAQFVILHGHKLAANHHYALDLICQRCNELRYLSDILVNEIKAKRIQLSRTFKMHKLLQQARQCCDEGECLLANQEIDKFQSKEDAQKALQDIENFLEMALPFINYEPETLQYEFDVILSPELKVQMKTIQLKLENIRSIFENQQAGFRNLADKHVRPIQFVVPTPENLVTSGTPFFSSKQGKKTWRQNQSNLKIEVVPDCQEKRSSGPSSSLDNGNSLDVLKNHVLNELIQTERVYVRELYTVLLGYRAEMDNPEMFDLMPPLLRNKKDILFGNMAEIYEFHNDIFLSSLENCAHAPERVGPCFLERKDDFQMYAKYCQNKPRSETIWRKYSECAFFQECQRKLKHRLRLDSYLLKPVQRITKYQLLLKELLKYSKDCEGSALLKKALDAMLDLLKSVNDSMHQIAINGYIGNLNELGKMIMQGGFSVWIGHKKGATKMKDLARFKPMQRHLFLYEKAIVFCKRRVESGEGSDRYPSYSFKHCWKMDEVGITEYVKGDNRKFEIWYGEKEEVYIVQASNVDVKMTWLKEIRNILLKQQELLTVKKRKQQDQLTERDKFQISLQQNDEKQQGAFISTEETELEHTSTVVEVCEAIASVQAEANTVWTEASQSAEISEEPAEWSSNYFYPTYDENEEENRPLMRPVSEMALLY
Alternative Products
Event=Alternative splicing; Named isoforms=6; Name=1; Synonyms=Var.1; IsoId=P10911-1; Sequence=Displayed; Name=2; Synonyms=Var.2; IsoId=P10911-2; Sequence=VSP_008151, VSP_008152; Name=3; Synonyms=Var.3; IsoId=P10911-3; Sequence=VSP_008150; Name=4; Synonyms=Var.4; IsoId=P10911-4; Sequence=VSP_008153; Name=5; IsoId=P10911-5; Sequence=VSP_008150, VSP_008153; Name=6; IsoId=P10911-6; Sequence=VSP_046118, VSP_008151, VSP_008152
Alternative Sequence
1..17; MAEANPRRGKMRFRRNA -> MQDIAFLSGGRGKDNAWIITFPENCNFRCIPEEVIAKVLTYLTSIARQNGSDSRFTIILDRRLDTWSSLKISLQKIS (in isoform 3 and isoform 5); 58..96; Missing (in isoform 6); 454; Q -> QVGVGYSFFQACKLFSK (in isoform 4 and isoform 5); 842..860; KQQGAFISTEETELEHTST -> DLCRRWLSYIDEATMSNGK (in isoform 2 and isoform 6); 861..925; Missing (in isoform 2 and isoform 6)
Domain & Motif Annotations
Repeat
221..322; Spectrin
Domain (CC)
The CRAL-TRIO domain is involved in interaction with inositol phospholipids.; DOMAIN: The DH domain is essential for transforming activity and directly catalyzes GDP-GTP exchange activity. It may interact with CCPG1.
Domain (FT)
1..88; CRAL-TRIO; 495..675; DH; 687..809; PH
Protein Families
MCF2 family
Sequence Similarities
Belongs to the MCF2 family.
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38617517 | Comprehensive analysis of exosome gene LYPD3 and prognosis/immune cell infiltration in lung cancer. | Further analysis showed that the up-regulation of LYPD3 in these 904 exosome molecules was associated with poor prognosis in LC. |