Protein detail
GTR2
Solute carrier family 2, facilitated glucose transporter member 2 (Glucose transporter type 2, liver) (GLUT-2)
Entry name GTR2 | UniProt ID | EVMP confidence score 0.40 |
Supporting publications (n) 4 | Transmembrane count 12 | Protein classification Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters |
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.70High >= 0.60Medium >= 0.40Low >= 0.30Basic Information
Protein Names
Solute carrier family 2, facilitated glucose transporter member 2 (Glucose transporter type 2, liver) (GLUT-2)
Protein Class (6)
Disease related genesHuman disease related genesMetabolic proteinsPotential drug targetsPredicted membrane proteinsTransporters
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of carbohydrate metabolism
- Potential drug targets
Transmembrane
11..31; Helical; Name=1; 99..119; Helical; Name=2; 128..148; Helical; Name=3; 159..179; Helical; Name=4; 188..208; Helical; Name=5; 218..238; Helical; Name=6; 304..324; Helical; Name=7; 339..359; Helical; Name=8; 369..389; Helical; Name=9; 401..421; Helical; Name=10; 434..454; Helical; Name=11; 462..482; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym (2)
GLUT-2GLUT2
Gene Description
Solute carrier family 2 member 2
Chromosome
3
Position
170996347-171026743
Supporting publications (n)
4
EVMP confidence score
0.40
Fluorescence & Localization
Brain Regional Specificchoroid plexusCell SpecificCone photoreceptor cellsSingle-Nuclei Brain Specificchoroid plexus epithelial cellBlood Cell Specificplasmacytoid DCBlood Lineage Specificdendritic cellsSecretome LocationSecreted to bloodSecretome FunctionReceptor
Function & Pathway
Protein Function (4)
- Transporters:Electrochemical Potential-driven transporters
- Disease related genes
- Human disease related genes:Congenital disorders of metabolism:Congenital disorders of carbohydrate metabolism
- Potential drug targets
Cellular Component (6)
Molecular Function (5)
Biological Process (3)
KEGG (8)
- hsa04911 Insulin secretion
- KEGG:hsa04917 Prolactin signaling pathway
- KEGG:hsa04922 Glucagon signaling pathway
- KEGG:hsa04930 Type II diabetes mellitus
- KEGG:hsa04931 Insulin resistance
- KEGG:hsa04950 Maturity onset diabetes of the young
- KEGG:hsa04973 Carbohydrate digestion and absorption
- KEGG:hsa05230 Central carbon metabolism in cancer
Reactome (11)
- R-hsa-189200 cellular hexose transport
- R-hsa-8963743 digestion and absorption
- R-hsa-5619115 disorders of transmembrane transporters
- R-hsa-163685 integration of energy metabolism
- R-hsa-8963676 intestinal absorption
- R-hsa-186712 regulation of beta cell development
- R-hsa-210745 regulation of gene expression in beta cells
- R-hsa-422356 regulation of insulin secretion
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-5619102 slc transporter disorders
Page 1 of 2
Mediation Categories (3)
Clinical-translation mediationFusion and delivery mediationMetabolism mediation
Relations & Evidence33
Enzyme-Mediated Modification (10)
10 records.
| Substrate Gene Symbol | Enzyme Gene Symbol | Enzyme UniProt ID | Residue Type | Residue Offset | Modification | Database | References |
|---|---|---|---|---|---|---|---|
| SLC2A2 | PRKACA | P17612 | S | 503 | phosphorylation | phosphoELM_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:8626492ProtMapper:8626492KEA:8626492SIGNOR:8626492 |
| SLC2A2 | PRKACA | P17612 | S | 505 | phosphorylation | phosphoELM_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:8626492ProtMapper:8626492KEA:8626492SIGNOR:8626492 |
| SLC2A2 | PRKACA | P17612 | S | 491 | phosphorylation | phosphoELM_MIMPMIMPHPRD_MIMPSIGNORProtMapperHPRDKEASIGNOR_ProtMapper | HPRD:8626492ProtMapper:8626492KEA:8626492SIGNOR:8626492 |
| SLC2A2 | PRKX | P51817 | S | 491 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMP | |
| SLC2A2 | PRKX | P51817 | S | 505 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMP | |
| SLC2A2 | PRKX | P51817 | S | 503 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMP | |
| SLC2A2 | PRKY | O43930 | S | 491 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMP | |
| SLC2A2 | PRKY | O43930 | S | 505 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMP | |
| SLC2A2 | PRKY | O43930 | S | 503 | phosphorylation | MIMPHPRD_MIMPphosphoELM_MIMP | |
| SLC2A2 | PRKCA | P17252 | S | 505 | phosphorylation | KEA | KEA:17570479 |
Ligand-Receptor Signaling (21)
21 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transmembrane | transmembrane | UniProt_topology | |||||
| transmembrane | transmembrane | UniProt_keyword | |||||
| transmembrane | transmembrane | LOCATE | |||||
| transmembrane | transmembrane | Ramilowski_location | |||||
| transmembrane | transmembrane | OmniPath | |||||
| plasma_membrane | plasma_membrane | UniProt_location | |||||
| plasma_membrane | plasma_membrane | Cellinker | |||||
| plasma_membrane | plasma_membrane | OmniPath | |||||
| cell_surface | cell_surface | Surfaceome | |||||
| cell_surface | cell_surface | OmniPath |
Regulatory Interaction Network (1)
1 record.
| Source Protein Symbol | Source UniProt ID | Target Protein Symbol | Target UniProt ID | Is Directed | Is Stimulation | Is Inhibition | Database | References |
|---|---|---|---|---|---|---|---|---|
| KAPCA | P17612 | GTR2 | P11168 | Yes | Yes | phosphoELM_MIMPMIMPHPRD_MIMPiPTMnetPhosphoPointSIGNORProtMapperHPRDPhosphoSite_KEAKEAHPRD_KEASIGNOR_ProtMapperHPRD-phos | HPRD:8626492ProtMapper:8626492HPRD-phos:8626492KEA:8626492SIGNOR:8626492 |
Sequence, Structure & Domains
Sequences
Length
524
Mass
57,490
Sequence
MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGDTLGRIKAMLVANILSLVGALLMGFSKLGPSHILIIAGRSISGLYCGLISGLVPMYIGEIAPTALRGALGTFHQLAIVTGILISQIIGLEFILGNYDLWHILLGLSGVRAILQSLLLFFCPESPRYLYIKLDEEVKAKQSLKRLRGYDDVTKDINEMRKEREEASSEQKVSIIQLFTNSSYRQPILVALMLHVAQQFSGINGIFYYSTSIFQTAGISKPVYATIGVGAVNMVFTAVSVFLVEKAGRRSLFLIGMSGMFVCAIFMSVGLVLLNKFSWMSYVSMIAIFLFVSFFEIGPGPIPWFMVAEFFSQGPRPAALAIAAFSNWTCNFIVALCFQYIADFCGPYVFFLFAGVLLAFTLFTFFKVPETKGKSFEEIAAEFQKKSGSAHRPKAAVEMKFLGATETV
Alternative Products
Event=Alternative splicing; Named isoforms=2; Name=1; IsoId=P11168-1; Sequence=Displayed; Name=2; IsoId=P11168-2; Sequence=VSP_054835
Alternative Sequence
1..123; MTEDKVTGTLVFTVITAVLGSFQFGYDIGVINAPQQVIISHYRHVLGVPLDDRKAINNYVINSTDELPTISYSMNPKPTPWAEEETVAAAQLITMLWSLSVSSFAVGGMTASFFGGWLGDTLG -> MHLN (in isoform 2)
Domain & Motif Annotations
Protein Families (3)
- Major facilitator superfamily
- Sugar transporter (TC 2.A.1.1) family
- Glucose transporter subfamily
Sequence Similarities
Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Clinical Relevance
Disease Involvement
Disease variant
Supporting Publications4
| PMID | Title | Related sentences |
|---|---|---|
| 36573687 | Proteomic and phosphoproteomic landscape of salivary extracellular vesicles to assess OSCC therapeutical outcomes. | No related sentences available |
| 38576002 | Therapy-induced senescent tumor cell-derived extracellular vesicles promote colorectal cancer progression through SERPINE1-mediated NF-κB p65 nuclear translocation. | No related sentences available |
| 39996590 | Surface Double Dendritic Magnetic Microfibrils for Rapid Isolation and Proteomic Profiling of Extracellular Vesicles from Microliters of Biofluids. | No related sentences available |
| 40596376 | Proteomic profiling of plasma extracellular vesicles identifies signatures of innate immunity, coagulation, and endothelial activation in septic patients. | No related sentences available |