Protein detail
GTR3
Solute carrier family 2, facilitated glucose transporter member 3 (Glucose transporter type 3, brain) (GLUT-3)
Entry name GTR3 | UniProt ID | EVMP confidence score 0.50 |
Supporting publications (n) 1 | Transmembrane count 12 | Protein classification Metabolic proteinsPredicted membrane proteinsTransporters |
EVMP confidence score
Annotation confidence score; open for threshold definitions.
Extremely high >= 0.85High >= 0.70Medium >= 0.55Low >= 0.40Basic Information13
Protein Names
Solute carrier family 2, facilitated glucose transporter member 3 (Glucose transporter type 3, brain) (GLUT-3)
Protein Class (3)
Metabolic proteinsPredicted membrane proteinsTransporters
Protein Function
Transporters:Electrochemical Potential-driven transporters
Transmembrane
11..32; Helical; Name=1; 65..85; Helical; Name=2; 91..111; Helical; Name=3; 119..142; Helical; Name=4; 154..174; Helical; Name=5; 184..204; Helical; Name=6; 270..290; Helical; Name=7; 305..325; Helical; Name=8; 332..352; Helical; Name=9; 364..389; Helical; Name=10; 400..420; Helical; Name=11; 430..450; Helical; Name=12
Transmembrane Count
12
Ensembl
Entrez Gene Symbol
Gene Synonym
GLUT3
Gene Description
Solute carrier family 2 member 3
Chromosome
12
Position
7919230-7936187
Supporting publications (n)
1
EVMP confidence score
0.50
Fluorescence & Localization2
Cell SpecificAlveolar cells type 1Single-Nuclei Brain Specificvascular associated smooth muscle cell
Function & Pathway7
Protein Function
Transporters:Electrochemical Potential-driven transporters
Cellular Component (10)
Molecular Function (5)
Biological Process (3)
Reactome (11)
- R-hsa-189200 cellular hexose transport
- R-hsa-168249 innate immune system
- R-hsa-9022699 mecp2 regulates neuronal receptors and channels
- R-hsa-196854 metabolism of vitamins and cofactors
- R-hsa-196849 metabolism of water soluble vitamins and cofactors
- R-hsa-6798695 neutrophil degranulation
- R-hsa-73857 rna polymerase ii transcription
- R-hsa-425407 slc mediated transmembrane transport
- R-hsa-8986944 transcriptional regulation by mecp2
- R-hsa-382551 transport of small molecules
Page 1 of 2
Canonical Pathways (3)
- M91 Pid tcptp pathway
- M50 Pid ptp1b pathway
- M160 Pid avb3 integrin pathway
Mediation Categories (3)
Fusion and delivery mediationImmune mediationMetabolism mediation
Relations & Evidence28
Ligand-Receptor Signaling (24)
24 records.
| Category | Parent | Database | Transmitter | Receiver | Secreted | Plasma Membrane (Transmembrane) | Plasma Membrane (Peripheral) |
|---|---|---|---|---|---|---|---|
| transporter | transporter | OmniPath | No | Yes | No | No | No |
| transmembrane | transmembrane | UniProt_location | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_topology | No | No | No | No | No |
| transmembrane | transmembrane | UniProt_keyword | No | No | No | No | No |
| transmembrane | transmembrane | TopDB | No | No | No | No | No |
| transmembrane | transmembrane | LOCATE | No | No | No | No | No |
| transmembrane | transmembrane | Ramilowski_location | No | No | No | No | No |
| transmembrane | transmembrane | OmniPath | No | No | No | No | No |
| plasma_membrane | plasma_membrane | UniProt_location | No | No | No | No | No |
| plasma_membrane | plasma_membrane | OmniPath | No | No | No | No | No |
Protein Complex Composition (3)
3 records.
| Component Name | Component Gene Symbols | Component UniProt ID | Stoichiometry | Database | Database IDs | References |
|---|---|---|---|---|---|---|
| GOLGB1KPNB1NUP153NUTF2RANRANBP1RANBP3RCC1SLC2A3UBCVRK1VRK3XPO1 | O14980P0CG48P11169P18754P43487P49790P61970P62826Q14789Q14974Q8IV63Q99986Q9H6Z4 | 1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC6263 | ||
| ARCN1ARF4COPACOPB1COPB2LMAN2SEC23ASFT2D1SLC2A3SURF4TMED10TMED2TMED7TMED9UBC | O15260P0CG48P11169P18085P35606P48444P49755P53618P53621Q12907Q15363Q15436Q8WV19Q9BVK6Q9Y3B3 | 1:1:1:1:1:1:1:1:1:1:1:1:1:1:1 | NetworkBlastCompleat | Compleat:HC7397 | ||
| SLC2A3 | P11169 | 2 | PDB | PDB:7spsPDB:4zwcPDB:5c65 |
Isolation & Detection Technology (1)
1 record.
| EV Isolation Method | Detection Method | Number of References | References |
|---|---|---|---|
| Differential Ultracentrifugation | Mass spectrometryWestern blotting | 1 | 37886648 |
Sequence, Structure & Domains11
Sequences
Length
496
Mass
53,924
Sequence
MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLLAVTGGCFMGLCKVAKSVEMLILGRLVIGLFCGLCTGFVPMYIGEISPTALRGAFGTLNQLGIVVGILVAQIFGLEFILGSEELWPLLLGFTILPAILQSAALPFCPESPRFLLINRKEEENAKQILQRLWGTQDVSQDIQEMKDESARMSQEKQVTVLELFRVSSYRQPIIISIVLQLSQQLSGINAVFYYSTGIFKDAGVQEPIYATIGAGVVNTIFTVVSLFLVERAGRRTLHMIGLGGMAFCSTLMTVSLLLKDNYNGMSFVCIGAILVFVAFFEIGPGPIPWFIVAELFSQGPRPAAMAVAGCSNWTSNFLVGLLFPSAAHYLGAYVFIIFTGFLITFLAFTFFKVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTTNV
3D Structural Models
Turn
111..115; 175..178; 181..183; 282..284; 356..358; 380..382; 395..397
Helix
8..29; 35..48; 56..79; 81..88; 90..96; 98..110; 117..145; 148..150; 151..173; 184..189; 192..201; 202..204; 209..214; 219..230; 236..251; 259..262; 264..281; 285..299; 304..355; 362..379; 383..391; 398..427; 428..430; 431..449; 458..469
Beta Strand
30..32; 50..52
3D Structure
X-ray crystallography (7)
Domain & Motif Annotations
Domain (CC)
Transport is mediated via a series of conformation changes, switching between a conformation where the substrate-binding cavity is accessible from the outside, and a another conformation where it is accessible from the cytoplasm.
Region
277..279; Important for selectivity against fructose
Protein Families (3)
- Major facilitator superfamily
- Sugar transporter (TC 2.A.1.1) family
- Glucose transporter subfamily
Sequence Similarities
Belongs to the major facilitator superfamily. Sugar transporter (TC 2.A.1.1) family. Glucose transporter subfamily.
Clinical Relevance2
Supporting Publications1
| PMID | Title | Abstract |
|---|---|---|
| 38731868 | The Deep Proteomics Approach Identified Extracellular Vesicular Proteins Correlated to Extracellular Matrix in Type One and Two Endometrial Cancer. | No abstract available |